DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thor and Eif4ebp1

DIOPT Version :9

Sequence 1:NP_001285588.1 Gene:Thor / 33569 FlyBaseID:FBgn0261560 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_031944.3 Gene:Eif4ebp1 / 13685 MGIID:103267 Length:117 Species:Mus musculus


Alignment Length:128 Identity:47/128 - (36%)
Similarity:74/128 - (57%) Gaps:22/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSASPTARQAITQALPMITRKVVISDPIQMPE-VYSSTPGGTLYSTTPGGTKLIYERAFMKNLRG 64
            |||..:..|..::|:|  ||:|.:.|.:|:|. .||:||||||:|||||||::||:|.|:...|.
Mouse     1 MSAGSSCSQTPSRAIP--TRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRN 63

  Fly    65 SPLSQTPPSNVPSCLLRGTPRTPFRKCVPVPTELIKQTKSLKI----ED------QEQFQLDL 117
            ||:::|||.::|:  :.|...       |...|...|....::    ||      :.||::|:
Mouse    64 SPVAKTPPKDLPA--IPGVTS-------PTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThorNP_001285588.1 eIF_4EBP 3..117 CDD:398880 44/124 (35%)
Eif4ebp1NP_031944.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 23/47 (49%)
eIF_4EBP 11..117 CDD:283183 42/116 (36%)
YXXXXLphi motif. /evidence=ECO:0000250|UniProtKB:P70445 53..59 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..117 14/61 (23%)
TOS motif. /evidence=ECO:0000269|PubMed:24139800 113..117 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838646
Domainoid 1 1.000 82 1.000 Domainoid score I8394
eggNOG 1 0.900 - - E1_2CQCV
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5145
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002674
OrthoInspector 1 1.000 - - otm44244
orthoMCL 1 0.900 - - OOG6_105200
Panther 1 1.100 - - LDO PTHR12669
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5872
SonicParanoid 1 1.000 - - X1786
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.