DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thor and Eif4ebp3

DIOPT Version :9

Sequence 1:NP_001285588.1 Gene:Thor / 33569 FlyBaseID:FBgn0261560 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_957708.1 Gene:Eif4ebp3 / 108112 MGIID:1270847 Length:101 Species:Mus musculus


Alignment Length:94 Identity:41/94 - (43%)
Similarity:62/94 - (65%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QMPEVYSSTPGGTLYSTTPGGTKLIYERAFMKNLRGSPLSQTPPSNVPSCLLRGT---PRTPFRK 90
            |:|:.||:|||||||:||||||::||:|.|:...:.||:::|||..:|.  :.|.   |..|   
Mouse    15 QLPDGYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQ--IPGVTTLPAVP--- 74

  Fly    91 CVPVPTELIKQTKSLKIE--DQEQFQLDL 117
              |...||:|:.|..::|  |.|||::|:
Mouse    75 --PSKLELLKEQKQTEVEITDDEQFEMDM 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThorNP_001285588.1 eIF_4EBP 3..117 CDD:398880 40/92 (43%)
Eif4ebp3NP_957708.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 8/12 (67%)
eIF_4EBP 5..101 CDD:283183 40/92 (43%)
YXXXXLphi motif. /evidence=ECO:0000250|UniProtKB:P70445 40..46 3/5 (60%)
TOS motif. /evidence=ECO:0000250|UniProtKB:Q13541 97..101 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838644
Domainoid 1 1.000 82 1.000 Domainoid score I8394
eggNOG 1 0.900 - - E1_2CQCV
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5145
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1597535at2759
OrthoFinder 1 1.000 - - FOG0002674
OrthoInspector 1 1.000 - - otm44244
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12669
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5872
SonicParanoid 1 1.000 - - X1786
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.890

Return to query results.
Submit another query.