DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31776 and LOC100486078

DIOPT Version :10

Sequence 1:NP_722909.2 Gene:CG31776 / 33568 FlyBaseID:FBgn0051776 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_002945237.1 Gene:LOC100486078 / 100486078 XenbaseID:XB-GENE-29078163 Length:139 Species:Xenopus tropicalis


Alignment Length:79 Identity:22/79 - (27%)
Similarity:37/79 - (46%) Gaps:12/79 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 CVDSLNCRHTKPVVLARCTGHNSMPGEHQNWSLTQDHEI--QLTNSKDDCLEAQGLRSKSVWLFR 558
            |.|:::  .|.||.|..|.|   |.| :|.|...:|..:  ..:||..||.|.:    ..:::.:
 Frog    56 CFDAVS--QTSPVTLFDCHG---MKG-NQLWKYRRDKTVYHPTSNSCMDCNEGE----YKIFMNK 110

  Fly   559 CHKNGGNQYWYYNH 572
            |:.:...|.|.:.|
 Frog   111 CNPSSPTQQWTFEH 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31776NP_722909.2 pp-GalNAc-T 170..467 CDD:133004
beta-trefoil_Ricin_Pgant8-like 482..618 CDD:467339 22/79 (28%)
LOC100486078XP_002945237.1 beta-trefoil_Ricin-like 3..136 CDD:483949 22/79 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.