DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pif1 and AT3G51690

DIOPT Version :9

Sequence 1:NP_001285587.1 Gene:Pif1 / 33567 FlyBaseID:FBgn0031540 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_190737.2 Gene:AT3G51690 / 824332 AraportID:AT3G51690 Length:331 Species:Arabidopsis thaliana


Alignment Length:258 Identity:66/258 - (25%)
Similarity:102/258 - (39%) Gaps:83/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 LCSHTNDANSINESKLENLDGDKILFKADDS-------DASMTRTLDQQIQAPS----QLYLKVN 484
            ||...:|.:.||:..|..|.|::....:.||       |..:...:...|:.|.    :|.|||.
plant   123 LCHRDDDVDQINDYMLSLLPGEEKECLSTDSISPSPNDDMFVPLEVLNSIKVPGLPDFKLRLKVG 187

  Fly   485 AQVMLLKNINISNGLVNGARGVVVRMEKDLPVVRFKNNQEYVC------------KHER--WIIK 535
            |.||||::::.|.|...|.|..:.|:                |            ||.:  ||.:
plant   188 APVMLLRDLDPSRGFFTGTRLQITRL----------------CGFLLEAMIIAGNKHGKKIWIPR 236

  Fly   536 TAS-------GNHITRRQVPLKLAWAFSIHKSQGLTLDCVEMSLSK-VFEAG-QAYVALSRAKSL 591
            .||       ...:.|.|.|||||:|.:|.:||..||..|.:.|.: ||..| |.:||:|:.||.
plant   237 IASYPTETNFPLQMRRTQYPLKLAFAMTIDESQVHTLSKVGLYLPRQVFSHGRQMFVAISKVKSR 301

  Fly   592 QSIRILDFDAKQVWANPHVLQFYKGFRRKLMDTTMIPLGPKNKDKKPGDKAANSALAKLKKSL 654
            ..:::|..|                                 ||..|.::|.|....:|.:::
plant   302 AGLKVLITD---------------------------------KDGNPQEEAKNVVFKELFQNI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pif1NP_001285587.1 P-loop_NTPase 205..510 CDD:304359 26/89 (29%)
AT3G51690NP_190737.2 P-loop_NTPase <43..213 CDD:304359 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002406
OrthoInspector 1 1.000 - - otm3076
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23274
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.