DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pif1 and Y53F4B.26

DIOPT Version :9

Sequence 1:NP_001285587.1 Gene:Pif1 / 33567 FlyBaseID:FBgn0031540 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_497112.1 Gene:Y53F4B.26 / 190222 WormBaseID:WBGene00013172 Length:152 Species:Caenorhabditis elegans


Alignment Length:145 Identity:35/145 - (24%)
Similarity:57/145 - (39%) Gaps:29/145 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NEGGSQPDDA--TLQKKLREHLMSGKPSSFNDVSPVTTAEMILARKKAGLLSKGS---------- 162
            ||..|:||..  |....|.:..|..||::..|. |.|:.|.:..|.::..||..|          
 Worm     3 NELTSRPDSIMDTEPTTLPDSAMDTKPTNLPDF-PSTSQEPVSRRTRSRTLSDNSNAVWKRERRS 66

  Fly   163 -VTTPSPQGAKKRRFEELKE------EKERGTMPAAKKLY--------ASTTDESLRLSEEQMEV 212
             .|:...:...:..:|..||      |:|:..|...|:::        |.|.|.|...:...:..
 Worm    67 RETSQESESRLRMDWERKKEKRASMSEEEKAEMKYKKRVWMKKKRNEVAKTHDTSSVANPNYLGS 131

  Fly   213 LR-ACTSGKSVFFTG 226
            :| .|.:..:.||.|
 Worm   132 MRCVCKNCNARFFQG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pif1NP_001285587.1 P-loop_NTPase 205..510 CDD:304359 5/23 (22%)
Y53F4B.26NP_497112.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.