DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pif1 and Y53F4B.7

DIOPT Version :10

Sequence 1:NP_608782.1 Gene:Pif1 / 33567 FlyBaseID:FBgn0031540 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_497092.1 Gene:Y53F4B.7 / 190210 WormBaseID:WBGene00013154 Length:152 Species:Caenorhabditis elegans


Alignment Length:145 Identity:35/145 - (24%)
Similarity:57/145 - (39%) Gaps:29/145 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NEGGSQPDDA--TLQKKLREHLMSGKPSSFNDVSPVTTAEMILARKKAGLLSKGS---------- 162
            ||..|:||..  |....|.:..|..||::..|. |.|:.|.:..|.::..||..|          
 Worm     3 NELTSRPDSIMDTEPTTLPDSAMDTKPTNLPDF-PSTSQEPVSRRTRSRTLSDNSNAVWKRERRS 66

  Fly   163 -VTTPSPQGAKKRRFEELKE------EKERGTMPAAKKLY--------ASTTDESLRLSEEQMEV 212
             .|:...:...:..:|..||      |:|:..|...|:::        |.|.|.|...:...:..
 Worm    67 RETSQESESRLRMDWERKKEKRASMSEEEKAEMKYKKRVWMKKKRNEVAKTHDTSSVANPNYLGS 131

  Fly   213 LR-ACTSGKSVFFTG 226
            :| .|.:..:.||.|
 Worm   132 MRCVCKNCNARFFQG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pif1NP_608782.1 RecD <190..591 CDD:440273 10/46 (22%)
DEXSc_Pif1_like 208..387 CDD:350795 5/20 (25%)
Y53F4B.7NP_497092.1 None

Return to query results.
Submit another query.