DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pif1 and Y116F11A.1

DIOPT Version :9

Sequence 1:NP_001285587.1 Gene:Pif1 / 33567 FlyBaseID:FBgn0031540 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001370092.1 Gene:Y116F11A.1 / 180297 WormBaseID:WBGene00013816 Length:202 Species:Caenorhabditis elegans


Alignment Length:166 Identity:47/166 - (28%)
Similarity:77/166 - (46%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LYASTTDESLRLSEEQMEVLRACTSGKSV--FFTGSAGTGKSFLLRRIISALPPD----GTVATA 252
            |:....||..:|..   :::|..:..|.|  ...|:|||||:||::.|.:::...    ..:.|.
 Worm    20 LHTMANDEQQQLLN---KIVRDDSQDKQVLLMINGAAGTGKTFLIKLIENSMNRSVRKRVVLMTG 81

  Fly   253 STGVAACLIGGTTLHAFAGIGGGDATMQRCLELASRPANAQTWR-------KCKRLIIDEISMVD 310
            |||.||..|||.|||...|:..            .:|.:.:..:       ..:.:|||||:::.
 Worm    82 STGKAAKAIGGRTLHCTIGLPN------------EKPEDLERLKYQAFICVTTRLIIIDEITLLA 134

  Fly   311 GQFFEKIEAVARHI-RRNDRPFGGIQLILCGDFLQL 345
            ....:..:.|.:.. :|.|..|||:.:||.||..||
 Worm   135 SWHLDATDMVLKRTPKRTDALFGGLSIILVGDLRQL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pif1NP_001285587.1 P-loop_NTPase 205..510 CDD:304359 44/155 (28%)
Y116F11A.1NP_001370092.1 DEAD-like_helicase_N 27..>170 CDD:421690 43/157 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2212
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.