DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3246 and CG34316

DIOPT Version :9

Sequence 1:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster


Alignment Length:250 Identity:48/250 - (19%)
Similarity:90/250 - (36%) Gaps:40/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AQVEAMLVHFQQEDPQGLP--GVPVPDPLEVPNVKKSMGMANL-----DMKQVKAYGLSKFRIDK 108
            |::.|.|..|:......:|  |:|..|||::...:..:....|     .:...:.:|||.|.:..
  Fly    30 AKILAFLQEFRMRMCHPIPNLGLPALDPLQLGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPA 94

  Fly   109 MNLD-LKEMRFNGGLQLDQMLVKGQYTLSSFFSKANGPFTVVLK-----NVYAEATAF-----LA 162
            ::|. :..::....:.|.....|..||       |.|....:|.     |.....|.|     ..
  Fly    95 LSLSPVPGLKNTINVTLPLTYFKSLYT-------AKGSLAYILNLAGDGNAETSITNFSILISFR 152

  Fly   163 VERDGQLATDRIKIDITFSDMTMDFQNL---GLVGSVFQSVVN--GAPNL--VFDAMKPFMLQEA 220
            :.....||...::|::....:.::|.||   ..:.....::||  |...|  |:|..:..::   
  Fly   153 LRSVSPLAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNEMGVELLGDVWDYEQGTVV--- 214

  Fly   221 DKKLRSEINVMIQKTLGERRLPNSITPLDSAIAMARKMVRQKGFDPYHLPDVNRT 275
                 |::...:...||:..|.:.|..:..............|.:|...||...|
  Fly   215 -----SKVQAAVNNFLGQYSLSDIIQIIIGGDGEGESAPIFDGVEPDCKPDATTT 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3246NP_608781.2 JHBP 31..246 CDD:214779 42/219 (19%)
Grp7_allergen 260..418 CDD:293589 4/15 (27%)
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 40/213 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.