DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3246 and CG17189

DIOPT Version :9

Sequence 1:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster


Alignment Length:292 Identity:53/292 - (18%)
Similarity:110/292 - (37%) Gaps:85/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIVVVLVGLMASGCHIVHSQEPGDAVEQEASESDDALKIKE------SQASIAAQVEAMLVHFQQ 62
            |::::..||..:.|...::::|...         ::.||.|      |..||.|        |..
  Fly     6 LLMLLHAGLQGAQCVAFYTEKPSYI---------ESCKIYEPEFTKCSTRSIQA--------FMN 53

  Fly    63 EDPQGLPGV-----PVPDPL-------EVPNVKKSMGMANLDMKQVKAYGLSKFRIDKMNLDLKE 115
            :..:|:|.:     |: ||:       :..|...:...|||....::.:|  |..|.:..:..|:
  Fly    54 QLVKGVPEIEESFGPI-DPMRQEQLVFKQDNSDVATLSANLTDMLIRGFG--KMLIKESKVSKKD 115

  Fly   116 MRFNGGLQLDQMLVKGQYTLSSFF----SKANGPFTVVLKNV-YAEATAFLAVERDG----QLAT 171
            ..:...:.|.||.:.|.|.:....    .:.||...:.:.:: ....|.....|:.|    .:.:
  Fly   116 FSWLTKIYLPQMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTS 180

  Fly   172 DRIKIDITFSDMTMDFQNLGLVGSVFQSVVNG-------APNL--------VFDAMKPFMLQEAD 221
            .::|:|:            |.|.:...::.||       :.|.        ||:|::|.:::..:
  Fly   181 VKVKVDV------------GKVRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVE 233

  Fly   222 KKLRSEINVMIQKTLG-------ERRLPNSIT 246
            :.|..    ::.||..       ...:|.|:|
  Fly   234 RTLLD----LLHKTFALFPASFFVEDIPTSLT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3246NP_608781.2 JHBP 31..246 CDD:214779 47/263 (18%)
Grp7_allergen 260..418 CDD:293589
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 46/265 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.