DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3246 and CG15497

DIOPT Version :9

Sequence 1:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster


Alignment Length:245 Identity:43/245 - (17%)
Similarity:88/245 - (35%) Gaps:60/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVVVLVGLMASGCHIVHSQEPGDAVEQEASESDDALKIKESQASIAAQVEAML--VHFQQED--- 64
            ::|.|.|:.....|:.::                     .||..:...::.:|  .|:..||   
  Fly    12 LLVYLAGISLFANHLANA---------------------SSQIDVDTDLKHLLGRCHWSDEDFNE 55

  Fly    65 -------------PQGLPGVPVP--DPLEVPNVK------KSMGMANLDMKQVKAYGLSKFRIDK 108
                         ..|:|...:.  ||.....|:      :.:|...|.::.|..||.::..:.|
  Fly    56 CMRQVFNDLRAYFTTGVPDYNIKPFDPHHCSYVELRRGESQGLGSFRLILRNVSEYGWARSEVTK 120

  Fly   109 MNLDLKEMRFNGGLQLDQMLVKGQYTLSSFFSK-------ANGPFTVVLKNVYAEATAFLAVERD 166
            .:.|.::.|...........::|:|   .|.:|       ..|.:.:.|.: |::.|:...:...
  Fly   121 FHADPEDQRIVYTQYFPDKSLEGEY---EFAAKMLGTEMNRKGHWNLTLYD-YSQTTSVRRIGGP 181

  Fly   167 GQLATDRIKIDITFSDMTMDFQNLGLVGSVFQSVVNGAPNLVFDAMKPFM 216
            |.|....:::| ....|.:..:|| |.|.....:.:|..|.::....||:
  Fly   182 GSLIKVHVEVD-RIGGMELHIENL-LQGQPLNQLADGVINSMWQLGLPFI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3246NP_608781.2 JHBP 31..246 CDD:214779 39/219 (18%)
Grp7_allergen 260..418 CDD:293589
CG15497NP_650976.1 JHBP 26..258 CDD:284096 39/231 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.