powered by:
Protein Alignment CG3246 and CG7079
DIOPT Version :9
Sequence 1: | NP_608781.2 |
Gene: | CG3246 / 33564 |
FlyBaseID: | FBgn0031538 |
Length: | 445 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001287436.1 |
Gene: | CG7079 / 42488 |
FlyBaseID: | FBgn0038849 |
Length: | 255 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 15/68 - (22%) |
Similarity: | 29/68 - (42%) |
Gaps: | 7/68 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 248 LDSAIAMAR---KMVRQKGFDPYHLPDVNRTMGVFSVQLAHTWINGISSFYRVGNITAGMANKTV 309
::||.|:.| |.:.:....|:::..|...:.|...|:...|. .|..:..|..|..|.|:
Fly 38 VESANALLRDFPKGIPEVDLKPFNVLSVRDWLLVNDSQVGGAWY----YFNLINQINYGFENTTI 98
Fly 310 SVV 312
:.:
Fly 99 TEI 101
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3246 | NP_608781.2 |
JHBP |
31..246 |
CDD:214779 |
|
Grp7_allergen |
260..418 |
CDD:293589 |
10/53 (19%) |
CG7079 | NP_001287436.1 |
JHBP |
20..249 |
CDD:214779 |
15/68 (22%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45470529 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11008 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.