DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3246 and CG10264

DIOPT Version :9

Sequence 1:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster


Alignment Length:187 Identity:42/187 - (22%)
Similarity:82/187 - (43%) Gaps:27/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GLP--GVPVPDPLEVPNVKKSMGMANL----DMKQVKAYGLSKFRIDKMNLDLKEMRFNGGLQLD 125
            |:|  ||...:||.:..|..|.|..||    ..:.:...|.|...:.:.:|||:....|..|:|.
  Fly    76 GIPEIGVKSFEPLNIDQVSVSKGSGNLVLSGGFQDLVIRGPSNATVRRASLDLERRLLNFELELP 140

  Fly   126 QMLVKGQYTLSSFFSKAN---------GPFTVVLKNVYAEATAFLAVERDGQLATDRIKIDITFS 181
            ::.::.:|.|     |.|         |...:.||||:......:::..:.:...:.|.||    
  Fly   141 RLRIRAKYNL-----KGNILLLPLVGSGDVAMALKNVHTTVYTRISLRNETRTGDEIIHID---- 196

  Fly   182 DMTMDFQNLGLVGSVFQSVVNGAPNLVFDAMKPFMLQEADKKLRSEINVMIQKTLGE 238
            :|.:.| ::|.:....:::.||  |.:..|.....|.:..|::.:|:...::..|.:
  Fly   197 EMKVGF-DVGAMRIHLKNLFNG--NEILAASINSFLNQNGKEVIAELRPDLELGLAD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3246NP_608781.2 JHBP 31..246 CDD:214779 42/187 (22%)
Grp7_allergen 260..418 CDD:293589
CG10264NP_650518.1 JHBP 42..270 CDD:214779 42/187 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.