DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3246 and CG14457

DIOPT Version :9

Sequence 1:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster


Alignment Length:173 Identity:32/173 - (18%)
Similarity:63/173 - (36%) Gaps:32/173 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GLPG---VPVPDPLEVPNVKKSMGMAN-----LDMKQVKAYGLSKFRIDKMNLDLKEMRFNGGLQ 123
            |:||   :...||..:..::.:.|.:|     :::..||..|.....:....:..|:..:.....
  Fly    60 GIPGLTSIRSFDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTFT 124

  Fly   124 LDQMLVKGQYTLSSFFSKANGPFTVVLKNVYAEATAFLAVERDGQLATDRIKIDITFSDMTMDFQ 188
            |.:|.::..|:|          |..:|         .:.:...||:..|...:.:|....|..:.
  Fly   125 LPEMKLQADYSL----------FGRIL---------LIPLNGKGQVFLDAENMTVTMHTKTRLYS 170

  Fly   189 NLGLVGSVFQSVVNGAPNLVFDAMKPFM--LQEADKKLRSEIN 229
            ..|.   .|.:|.|...:...|.:|.:.  |...:|:|....|
  Fly   171 KGGF---TFYNVTNLHVDFKMDGLKSYFSNLFNGNKQLEDSTN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3246NP_608781.2 JHBP 31..246 CDD:214779 32/173 (18%)
Grp7_allergen 260..418 CDD:293589
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 32/173 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.