DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and ZFAND2A

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001352312.1 Gene:ZFAND2A / 90637 HGNCID:28073 Length:180 Species:Homo sapiens


Alignment Length:162 Identity:80/162 - (49%)
Similarity:108/162 - (66%) Gaps:9/162 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEFPHLGQHCSEATCNRLDFLPVKCDSCDKVFCASHYSYDRHSCPGAYKKNVQVPVCPLCREPVP 65
            ||||.||:||||.||.:|||||||||:|.:.||..|:.|..|.||.|::|:|.|||||||..|:|
Human     1 MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCPFAFQKDVHVPVCPLCNTPIP 65

  Fly    66 TPPGVEPDVTVGQHIDQQCKS----ESKKIYTNRCNAKGCKRKELIPVTCSQCRLNFCLRHRHTS 126
            ...|..|||.||.|||:.|.|    :.:||:|.||:.:|||:||::.:.|:||..|||::|||..
Human    66 VKKGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPL 130

  Fly   127 DHDCKPVPASSTTSSRGGFQSIFKTSSDSRSM 158
            ||.|:   ..|..:.:.|...:  |.|:||.:
Human   131 DHSCR---HGSRPTIKAGCSPM--TVSESRPL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 21/35 (60%)
zf-AN1 96..131 CDD:279736 17/34 (50%)
ZFAND2ANP_001352312.1 zf-AN1 10..46 CDD:307540 21/35 (60%)
zf-AN1 100..134 CDD:307540 17/33 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154594
Domainoid 1 1.000 60 1.000 Domainoid score I10599
eggNOG 1 0.900 - - E1_KOG3183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422113at2759
OrthoFinder 1 1.000 - - FOG0002265
OrthoInspector 1 1.000 - - otm41137
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14677
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4414
SonicParanoid 1 1.000 - - X1690
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.