DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and CUZ1

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_014244.1 Gene:CUZ1 / 855567 SGDID:S000005099 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:227 Identity:46/227 - (20%)
Similarity:84/227 - (37%) Gaps:52/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGQHCSEATCNRLDFLPVKCDSCDKVFCASHYSYDRHSCPGAYKKNVQVPVCPLCREPVPTPPGV 70
            :|:||  |.|.:|||||..|..|::.||::|...:.|.|....:.                    
Yeast    14 VGKHC--AYCRQLDFLPFHCSFCNEDFCSNHRLKEDHHCRWLLEH-------------------- 56

  Fly    71 EPDVTVGQHIDQQCKSESKKIYTNRCNAKGCKRKELIPVTCSQCRLNFCLRHRHTSDHDCKPVPA 135
                   :.:.:..||.||....:..|.: ...|.|:|...|       :|.:..|: ..:|:..
Yeast    57 -------EEVHKTEKSPSKSRDGSSSNDE-AYFKSLLPERAS-------VRIQRVSE-TREPLRG 105

  Fly   136 SSTTSSRGGFQSIFKTSSDSRSMAAQAAERRQNRRPASNSISNTNSRPRPVQATQVQNIQGNMSE 200
            |:|........|  ||.........:..:|:.|.:...|..|::|      :..|:.|::.....
Yeast   106 SNTAKVSSTLNS--KTLDKIFKFFQRNEKRKSNNKSKKNFGSSSN------KIIQLANLKKIAKG 162

  Fly   201 DEALARALALSIM------EQDDAAESNRQAP 226
            |..:.....:.|.      ::.|.|:.:.:.|
Yeast   163 DPKIPMQNRIYIWCYLVDGDETDIAKEDTRMP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 15/35 (43%)
zf-AN1 96..131 CDD:279736 7/34 (21%)
CUZ1NP_014244.1 ZnF_AN1 18..55 CDD:197545 15/38 (39%)
COG3582 90..274 CDD:226110 21/121 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3183
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2130
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002265
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14677
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.820

Return to query results.
Submit another query.