DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and AT3G57480

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001319783.1 Gene:AT3G57480 / 824915 AraportID:AT3G57480 Length:249 Species:Arabidopsis thaliana


Alignment Length:222 Identity:70/222 - (31%)
Similarity:109/222 - (49%) Gaps:39/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EFPHLGQHCSEATCNRLDFLPVKCDSCDKVFCASHYSYDRHSCPGAYKKNVQVPVCPLCREPVPT 66
            |||.||:|||...|.::||||..||.|.:|:|..|.||.:|.||...:.:|.|.:||||.:.|..
plant     5 EFPDLGKHCSVDYCKQIDFLPFTCDRCLQVYCLDHRSYMKHDCPKGNRGDVTVVICPLCAKGVRL 69

  Fly    67 PPGVEPDVTVGQHIDQQC--KSESKKIYTNRCNAKGCKRKELI----PVTCSQCRLNFCLRHRHT 125
            .|..:|::|..:|::..|  .:..|.:...:|....|  :||:    .:.|..|.::.||:||..
plant    70 NPDEDPNITWEKHVNTDCDPSNYEKAVKKKKCPVPRC--RELLTFSNTIKCRDCSIDHCLKHRFG 132

  Fly   126 SDHDC--------------------KPVPASSTTSSRGGFQSIFKTSSDSRSMAAQAAERRQNRR 170
            .||.|                    |..||||::|||  :.|:|  :|...|::....:..|..:
plant   133 PDHSCSGPKKPESSFSFMGFLSTNTKEAPASSSSSSR--WSSLF--ASAEASISRLGNDISQKLQ 193

  Fly   171 PASNSISNTNSRPRPVQATQVQNIQGN 197
            .||.:..|:       :.||.:|.:.|
plant   194 FASGNDGNS-------EKTQERNGKQN 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 17/35 (49%)
zf-AN1 96..131 CDD:279736 13/58 (22%)
AT3G57480NP_001319783.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4267
eggNOG 1 0.900 - - E1_KOG3183
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1989
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422113at2759
OrthoFinder 1 1.000 - - FOG0002265
OrthoInspector 1 1.000 - - otm2974
orthoMCL 1 0.900 - - OOG6_102690
Panther 1 1.100 - - O PTHR14677
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1690
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.