DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and PMZ

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001327074.1 Gene:PMZ / 822447 AraportID:AT3G28210 Length:186 Species:Arabidopsis thaliana


Alignment Length:187 Identity:63/187 - (33%)
Similarity:88/187 - (47%) Gaps:23/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FPHLGQHCSEATCNRLDFLPVKCDSCDKVFCASHYSYDRHSCPGAYKKNVQVPVCPLCREPVPTP 67
            ||.||:||.:..|..|||||..||.|..|||..|.||..|:||.:...:..|.:|..|...:.|.
plant     9 FPDLGEHCQDPDCKLLDFLPFTCDGCKLVFCLEHRSYKSHNCPKSDHGSRTVSICETCSIAIETT 73

  Fly    68 PGVEPDV--TVGQH-IDQQCKSESKKIYTNRCNAKGCKRKELIP----VTCSQCRLNFCLRHRHT 125
            ...|..:  .:.:| ....|....||..|  |..|.|  ||::.    :||..|.:.|||:||..
plant    74 GFDEKGIKSLLEKHERSGDCDPNKKKKPT--CPVKRC--KEILTFANNLTCKYCGVKFCLKHRFP 134

  Fly   126 SDHDC-KPVPASSTTSSRGGFQSIFKTSSDSRSMAAQAAERRQNRRPASNSISNTNS 181
            :||.| |.:..::.||||.          :.|.|.|.:. |.|......:|:|:.:|
plant   135 TDHVCNKKIINTAGTSSRW----------NERFMEALSL-RNQKGCGRGSSVSSKSS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 18/35 (51%)
zf-AN1 96..131 CDD:279736 16/39 (41%)
PMZNP_001327074.1 zf-AN1 16..52 CDD:376545 18/35 (51%)
zf-AN1 103..141 CDD:376545 16/39 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4267
eggNOG 1 0.900 - - E1_KOG3183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1989
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422113at2759
OrthoFinder 1 1.000 - - FOG0002265
OrthoInspector 1 1.000 - - otm2974
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14677
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1690
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.