DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and ZFAND1

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_078975.2 Gene:ZFAND1 / 79752 HGNCID:25858 Length:268 Species:Homo sapiens


Alignment Length:174 Identity:57/174 - (32%)
Similarity:79/174 - (45%) Gaps:46/174 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGQHCSEATCNRLDFLPVKCDSCDKVFCASHYSYDRHSCPGAYKKNVQVPVCPLCREPVPTPPGV 70
            :||||....|.:.||||..||.|..:||..|.|.:.|.|                          
Human     6 IGQHCQVEHCRQRDFLPFVCDDCSGIFCLEHRSRESHGC-------------------------- 44

  Fly    71 EPDVTVGQHIDQQCKSESKKIYTNRCNAKGCKRKELIPVTCSQCRLNFCLRHRHTSDHDCK---- 131
             |:|||   |:::.|::....|.  |:.|.|..:||:.|.|..|..||||||||.|||:|:    
Human    45 -PEVTV---INERLKTDQHTSYP--CSFKDCAERELVAVICPYCEKNFCLRHRHQSDHECEKLEI 103

  Fly   132 PVPASSTTSSRGGFQSIFKTSSDSRSMAAQAAERRQNRRPASNS 175
            |.|..:.|      |.:.|...||::  .:.|.:|.  :.|.||
Human   104 PKPRMAAT------QKLVKDIIDSKT--GETASKRW--KGAKNS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 15/35 (43%)
zf-AN1 96..131 CDD:279736 19/34 (56%)
ZFAND1NP_078975.2 zf-AN1 10..46 CDD:279736 15/62 (24%)
zf-AN1 64..100 CDD:279736 20/35 (57%)
ubiquitin-like. /evidence=ECO:0000303|PubMed:29804830 160..260
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.