DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and Zfand2b

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001153377.1 Gene:Zfand2b / 68818 MGIID:1916068 Length:257 Species:Mus musculus


Alignment Length:255 Identity:103/255 - (40%)
Similarity:150/255 - (58%) Gaps:10/255 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEFPHLGQHCSEATCNRLDFLPVKCDSCDKVFCASHYSYDRHSCPGAYKKNVQVPVCPLCREPVP 65
            ||||.||.||||.:|.||||||:|||:|..:|||.|.:|.:|.|..||:|::||||||||..|||
Mouse     1 MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVP 65

  Fly    66 TPPGVEPDVTVGQHIDQQCKS----ESKKIYTNRCNAKGCKRKELIPVTCSQCRLNFCLRHRHTS 126
            ...|..||..||:|||:.|:|    :.:||:||:|...||:::|::.:||.:|..|||::|||..
Mouse    66 VARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSGCRQREMMKLTCDRCGRNFCIKHRHPL 130

  Fly   127 DHDCKPVPASSTTSSRGGFQSIFKTSSDSRSMAAQAAERRQNRRPASNSISNTNSRPRPVQATQV 191
            ||:|.   .....:||.|..:|.:....:.:..|.:..|   ..|:|:|.|....:.....|:.|
Mouse   131 DHECS---GEGHQTSRAGLAAISRAQGLASTSTAPSPSR---TLPSSSSPSRATPQLPTRTASPV 189

  Fly   192 QNIQGNMSEDEALARALALSIMEQDDAAESNRQAPAPSNAQQVAVGGGGNQQGNGKDKCL 251
            ..:|..:||||||.|||.||:.|......|:::....:.||.::......||...:.:.|
Mouse   190 IALQNGLSEDEALQRALELSLAEAKPQVLSSQEEDDLALAQALSASEAEYQQQQAQSRSL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 21/35 (60%)
zf-AN1 96..131 CDD:279736 15/34 (44%)
Zfand2bNP_001153377.1 zf-AN1 10..46 CDD:279736 21/35 (60%)
zf-AN1 100..136 CDD:279736 16/38 (42%)
VCP/p97-interacting motif (VIM). /evidence=ECO:0000305|PubMed:24160817 141..151 4/9 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..184 6/34 (18%)
UIM 197..213 CDD:280900 11/15 (73%)
CAAX motif. /evidence=ECO:0000305|PubMed:18467495 254..257
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844869
Domainoid 1 1.000 62 1.000 Domainoid score I10369
eggNOG 1 0.900 - - E1_KOG3183
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32671
Inparanoid 1 1.050 209 1.000 Inparanoid score I3675
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002265
OrthoInspector 1 1.000 - - otm43207
orthoMCL 1 0.900 - - OOG6_102690
Panther 1 1.100 - - LDO PTHR14677
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4414
SonicParanoid 1 1.000 - - X1690
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.780

Return to query results.
Submit another query.