DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and Zfand1

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011246448.1 Gene:Zfand1 / 66361 MGIID:1913611 Length:278 Species:Mus musculus


Alignment Length:248 Identity:62/248 - (25%)
Similarity:92/248 - (37%) Gaps:77/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGQHCSEATCNRLDFLPVKCDSCDKVFC----------------ASHYSYDRHSCPGAYKKNVQV 54
            :||||....|.:      :.|:...:|.                ..|.|.|.|.|          
Mouse     6 IGQHCQVQHCRQ------RGDAGSPIFIRGRPGPGSDGRGGGGGLEHRSKDSHGC---------- 54

  Fly    55 PVCPLCREPVPTPPGVEPDVTVGQHIDQQCKSESKKIYTNRCNAKGCKRKELIPVTCSQCRLNFC 119
                             .:|.|   :.::.|::..|.|:  |:.|||...||:.|.|..|..|||
Mouse    55 -----------------SEVNV---VKERPKTDEHKSYS--CSFKGCTDVELVAVICPYCEKNFC 97

  Fly   120 LRHRHTSDHDC------KPVPASS-------TTSSRGGFQSIFKTSSDSRSMAAQAA-ERRQNRR 170
            |||||.|||||      ||..|::       ..:..||..|..:..:.|...||:.| .:.:...
Mouse    98 LRHRHQSDHDCEKLEVAKPRMAATQKLVRDIVDAKTGGAASKGRKGAKSSGTAAKVALMKLKMHA 162

  Fly   171 PASNSISNTNSRPRPVQAT--QVQNIQGNMSEDEALARALALSIMEQDDAAES 221
            ....|:..|       :.|  ||...:|:..:.:|:...|..||.:..|.|.|
Mouse   163 DGDKSLPQT-------ERTYFQVYLPKGSKEKSKAMFFCLRWSIGKVVDFAAS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 9/51 (18%)
zf-AN1 96..131 CDD:279736 22/40 (55%)
Zfand1XP_011246448.1 zf-AN1 74..110 CDD:376545 22/35 (63%)
Periplasmic_Binding_Protein_Type_2 <130..201 CDD:389745 17/77 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10916
eggNOG 1 0.900 - - E1_KOG3183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.