DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and zfand2a

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001016899.2 Gene:zfand2a / 549653 XenbaseID:XB-GENE-5772103 Length:259 Species:Xenopus tropicalis


Alignment Length:253 Identity:108/253 - (42%)
Similarity:144/253 - (56%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEFPHLGQHCSEATCNRLDFLPVKCDSCDKVFCASHYSYDRHSCPGAYKKNVQVPVCPLCREPVP 65
            ||||.||.|||||||.:|||||:|||:|:::||..|.:||:|.|..||||||.|||||||..|||
 Frog     1 MEFPDLGHHCSEATCKQLDFLPLKCDACEELFCKDHITYDQHKCSAAYKKNVLVPVCPLCGTPVP 65

  Fly    66 TPPGVEPDVTVGQHIDQQCKSESK-KIYTNRCNAKGCKRKELIPVTCSQCRLNFCLRHRHTSDHD 129
            ...|...|:.|.||||:.|.|..| ||:||||...|||:|||:.|.|..|..||||.|||..|||
 Frog    66 VNKGEMADIAVSQHIDRNCTSNHKQKIFTNRCFKAGCKKKELMKVICDHCHNNFCLSHRHPLDHD 130

  Fly   130 CKPVPASSTTSSRGGFQSIFKTSSDSRSMAAQAAERRQNRRPASNSISNTNSR---------PRP 185
            ||   ......|:.|..::.::...|:..:.:..|..::.|..::....:|.:         |:.
 Frog   131 CK---TGKPVISKSGLAALSRSKVASQDYSLKVNEATKSTRTKTSGSVKSNKKKNIFPGSAGPKV 192

  Fly   186 VQATQVQNIQGNMSEDEALARALALSIME-----------QDDAAESNRQAPAPSNAQ 232
            :..    .||..::|||||.:||.||::|           ||:..|. .||.|.|..:
 Frog   193 ISV----EIQNGLNEDEALKKALELSLLETGVNNLLTLSPQDEDGEL-EQALAASREE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 22/35 (63%)
zf-AN1 96..131 CDD:279736 20/34 (59%)
zfand2aNP_001016899.2 zf-AN1 10..45 CDD:279736 21/34 (62%)
COG3582 21..161 CDD:226110 69/142 (49%)
zf-AN1 97..132 CDD:279736 20/34 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4414
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.