DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and Zfand1

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_342214.4 Gene:Zfand1 / 361917 RGDID:1309519 Length:268 Species:Rattus norvegicus


Alignment Length:232 Identity:72/232 - (31%)
Similarity:97/232 - (41%) Gaps:55/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGQHCSEATCNRLDFLPVKCDSCDKVFCASHYSYDRHSCPGAYKKNVQVPVCPLCREPVPTPPGV 70
            :||||....|.:.||||..||.|..:||..|.|.|.|.||.|   ||                  
  Rat     6 IGQHCQVQHCRQRDFLPFVCDGCSGIFCLEHRSKDSHGCPEA---NV------------------ 49

  Fly    71 EPDVTVGQHIDQQCKSESKKIYTNRCNAKGCKRKELIPVTCSQCRLNFCLRHRHTSDHDCK---- 131
                     |.::.|::..|.|.  |:.|||...||:.|.|..|..||||||||.|||:|:    
  Rat    50 ---------IKERLKTDEHKSYP--CSFKGCAEVELVAVICPYCEKNFCLRHRHQSDHECEKLEI 103

  Fly   132 PVPASSTT---------SSRGGFQSI-FKTSSDSRSMAAQAAERRQNRRPASNSISNTNSRPRPV 186
            |.|..:.|         :..||..|. .|.:..||:.|..|..:.:.......|:..|       
  Rat   104 PKPRMAATQKLVRDIVDAKAGGAASKGRKGAKSSRTAAKVALMKLKMHADGDKSLPQT------- 161

  Fly   187 QAT--QVQNIQGNMSEDEALARALALSIMEQDDAAES 221
            :.|  ||...:|:..:.:|:...|..||.:..|.|.|
  Rat   162 ERTYFQVYLPKGSQEKSKAMFFCLRWSIGKVVDVAAS 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 16/35 (46%)
zf-AN1 96..131 CDD:279736 20/34 (59%)
Zfand1XP_342214.4 zf-AN1 10..46 CDD:279736 16/35 (46%)
zf-AN1 64..100 CDD:279736 21/35 (60%)
Periplasmic_Binding_Protein_Type_2 <120..191 CDD:304360 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10819
eggNOG 1 0.900 - - E1_KOG3183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.