DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and ZFAND2B

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006712348.1 Gene:ZFAND2B / 130617 HGNCID:25206 Length:338 Species:Homo sapiens


Alignment Length:244 Identity:105/244 - (43%)
Similarity:142/244 - (58%) Gaps:34/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEFPHLGQHCSEATCNRLDFLPVKCDSCDKVFCASHYSYDRHSCPGAYKKNVQVPVCPLCREPVP 65
            ||||.||.||||.:|.||||||:|||:|..:|||.|.:|.:|.|..||:|::||||||||..|||
Human     1 MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVP 65

  Fly    66 TPPGVEPDVTVGQHIDQQCKS----ESKKIYTNRCNAKGCKRKELIPVTCSQCRLNFCLRHRHTS 126
            ...|..||..||:|||:.|:|    :.:||:||:|...||:::|::.:||.:|..|||::|||..
Human    66 VARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPL 130

  Fly   127 DHDCKPVPASSTTSSRGGF------QSIFKTS---SDSRSMAAQAAERRQNRRPASNSISNTNSR 182
            ||||.   .....:||.|.      |::..||   |.|::|            |:..|.|...:|
Human   131 DHDCS---GEGHPTSRAGLAAISRAQAVASTSTVPSPSQTM------------PSCTSPSRATTR 180

  Fly   183 PRPVQATQVQNIQGNMSEDEALARALALSIMEQDDAAESNRQAPAPSNA 231
            .....|..|..:|..:||||||.|||.:|:      ||:..|.|.|..|
Human   181 SPSWTAPPVIALQNGLSEDEALQRALEMSL------AETKPQVPRPRAA 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 21/35 (60%)
zf-AN1 96..131 CDD:279736 16/34 (47%)
ZFAND2BXP_006712348.1 zf-AN1 10..46 CDD:279736 21/35 (60%)
zf-AN1 100..136 CDD:279736 17/38 (45%)
UIM 197..212 CDD:280900 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154593
Domainoid 1 1.000 62 1.000 Domainoid score I10426
eggNOG 1 0.900 - - E1_KOG3183
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32671
Inparanoid 1 1.050 206 1.000 Inparanoid score I3721
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422113at2759
OrthoFinder 1 1.000 - - FOG0002265
OrthoInspector 1 1.000 - - otm41137
orthoMCL 1 0.900 - - OOG6_102690
Panther 1 1.100 - - LDO PTHR14677
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4414
SonicParanoid 1 1.000 - - X1690
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.