DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and zfand2b

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_004917699.1 Gene:zfand2b / 100487091 XenbaseID:XB-GENE-5994975 Length:266 Species:Xenopus tropicalis


Alignment Length:274 Identity:112/274 - (40%)
Similarity:155/274 - (56%) Gaps:29/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEFPHLGQHCSEATCNRLDFLPVKCDSCDKVFCASHYSYDRHSCPGAYKKNVQVPVCPLCREPVP 65
            ||||.||:||||.||.:|||||:|||:|:::||..|.:|.:|.|..||||:|||||||||..|:|
 Frog     1 MEFPDLGKHCSETTCKQLDFLPLKCDACEQIFCKDHITYTQHKCSSAYKKDVQVPVCPLCNTPIP 65

  Fly    66 TPPGVEPDVTVGQHIDQQCKS----ESKKIYTNRCNAKGCKRKELIPVTCSQCRLNFCLRHRHTS 126
            ...|..||:.||:|||:.|||    :.:||:||:|...||::|||:.|.|..|..||||:|||..
 Frog    66 ITRGQTPDIVVGEHIDRDCKSDPARQKRKIFTNKCAKPGCRQKELMKVICEDCHGNFCLKHRHPL 130

  Fly   127 DHDCKPVPASSTTSSRGGFQSIFKTSSDSRSMAAQAAERRQNRRPASNSISNTNSRP--RPVQAT 189
            ||:||   ..|...||.|..::.:  |...:..|.|.......|||:.......|.|  :|..|.
 Frog   131 DHECK---GKSAPISRAGHAALLR--SQPSTSKASAPSSHAAPRPATQPPRIRTSVPSAQPPAAA 190

  Fly   190 QVQNIQGNMSEDEALARALALSIMEQDDAAESNRQAPAPSNAQQVAVGGGGNQ-----------Q 243
            .:||   .::|:|||.|||.:|:.|...||.:..|:.:....:.:|:....:.           |
 Frog   191 SLQN---GLTEEEALQRALEMSLAESSGAAAAAAQSHSSQEEEDLALARALSASEEEYRRQQAIQ 252

  Fly   244 GNGKD----KCLLS 253
            |..:|    .|.||
 Frog   253 GQNRDAKQSMCSLS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 20/35 (57%)
zf-AN1 96..131 CDD:279736 18/34 (53%)
zfand2bXP_004917699.1 zf-AN1 10..46 CDD:376545 20/35 (57%)
P-loop_NTPase <69..116 CDD:393306 22/46 (48%)
zf-AN1 100..136 CDD:376545 20/38 (53%)
rad23 <137..>208 CDD:273167 23/75 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9846
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H32671
Inparanoid 1 1.050 197 1.000 Inparanoid score I3696
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422113at2759
OrthoFinder 1 1.000 - - FOG0002265
OrthoInspector 1 1.000 - - oto103471
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1690
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.