DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12795 and zfand1

DIOPT Version :9

Sequence 1:NP_001097074.1 Gene:CG12795 / 33561 FlyBaseID:FBgn0031535 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002936669.1 Gene:zfand1 / 100141502 XenbaseID:XB-GENE-1217582 Length:268 Species:Xenopus tropicalis


Alignment Length:174 Identity:60/174 - (34%)
Similarity:75/174 - (43%) Gaps:46/174 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGQHCSEATCNRLDFLPVKCDSCDKVFCASHYSYDRHSCPGAYKKNVQVPVCPLCREPVPTPPGV 70
            :|||||...|.:|||||.:||.|..|||..|.|.:.|.||...:.|                   
 Frog     6 VGQHCSAENCGQLDFLPFRCDGCSGVFCLEHRSRESHGCPEIPQSN------------------- 51

  Fly    71 EPDVTVGQHIDQQCKSESKKIYTNRCNAKGCKRKELIPVTCSQCRLNFCLRHRHTSDHDCK---- 131
                .:|       |||....|.  |..:.|..|||:||.|..|..:|||.|||.|||:|.    
 Frog    52 ----DLG-------KSEGSTQYP--CMYESCSGKELVPVLCPYCEKHFCLGHRHQSDHECSKLDG 103

  Fly   132 PVPASSTTSSRGGFQSIFKTSSDSRSMAAQAAERRQNRRPASNS 175
            |.|....|      |.:.|...||:    ::|...:.||.|.||
 Frog   104 PKPRMVAT------QQLVKEIVDSK----KSAPNCKVRRGAKNS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12795NP_001097074.1 zf-AN1 10..46 CDD:279736 18/35 (51%)
zf-AN1 96..131 CDD:279736 18/34 (53%)
zfand1XP_002936669.1 zf-AN1 10..46 CDD:376545 18/35 (51%)
zf-AN1 64..100 CDD:376545 19/35 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422113at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.