DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx1 and Snx3

DIOPT Version :10

Sequence 1:NP_608777.1 Gene:Snx1 / 33560 FlyBaseID:FBgn0031534 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001037748.1 Gene:Snx3 / 684097 RGDID:1595151 Length:162 Species:Rattus norvegicus


Alignment Length:146 Identity:44/146 - (30%)
Similarity:77/146 - (52%) Gaps:12/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FISIVVSDPQKIGDGMGSYLAYKVTTKTNIPKFKRSEFSTLRRFSDFLGIHDLLVGKYMRLGR-I 137
            |:.|.||:||.:|.|.|.:..|::..|||:|.||..|.:..||:|||    :.|..:..|..: :
  Rat    28 FLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDF----EWLRSELERESKVV 88

  Fly   138 IPPAPSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALERFVHRTAQHPVLRVDLDFMNFLES 202
            :||.|.|..:     :..|.:.:.|. ....::|.|:..||:|:::.|.||:.:.:.....||: 
  Rat    89 VPPLPGKAFL-----RQLPFRGDDGI-FDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQ- 146

  Fly   203 DQELPRSVNTSALSGA 218
            |:.:.:|...|.:..|
  Rat   147 DEIIDKSYTPSKIRHA 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx1NP_608777.1 PX_SNX1_2_like 75..203 CDD:132769 39/128 (30%)
BAR_SNX1_2 232..455 CDD:153307
Snx3NP_001037748.1 PX_SNX3 28..150 CDD:132826 41/132 (31%)
Binds predominantly to PtdIns(P5) and weaker to PtdIns(P3) abd PtdIns(P4), involved in neurite outgrowth regulation. /evidence=ECO:0000250|UniProtKB:O70492 147..162 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.