DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx1 and SNX30

DIOPT Version :9

Sequence 1:NP_608777.1 Gene:Snx1 / 33560 FlyBaseID:FBgn0031534 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_011516993.1 Gene:SNX30 / 401548 HGNCID:23685 Length:443 Species:Homo sapiens


Alignment Length:472 Identity:112/472 - (23%)
Similarity:197/472 - (41%) Gaps:122/472 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SPE--HTRDFAEVDI---NNGAATGSEDEEEEVPAPGSVTLDRNESDLFVSALSPSSIGDIHPLQ 64
            ||:  ..|.|.:.|:   |.|...|:..     ||..|..|:|.:.|           .||    
Human    40 SPDLLMARSFGDKDLILPNGGTPAGTSS-----PASSSSLLNRLQLD-----------DDI---- 84

  Fly    65 EVLTDDG---DYFISIVVSDPQKIGDGMGSYLAYKVTTKTNIPKFKRSEFSTLRRFSDFLGIHDL 126
                 ||   |.|  ::|.||:|....|.:|:.|::|||:...:|...|:|..||:.||    |.
Human    85 -----DGETRDLF--VIVDDPKKHVCTMETYITYRITTKSTRVEFDLPEYSVRRRYQDF----DW 138

  Fly   127 LVGKY--MRLGRIIPPAPSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALERFVHRTAQHPV 189
            |..|.  .:...:|||.|.|.::.....:.|           :|:||.||.||::|:.|...|||
Human   139 LRSKLEESQPTHLIPPLPEKFVVKGVVDRFS-----------EEFVETRRKALDKFLKRITDHPV 192

  Fly   190 LRVDLDFMNFLESDQELPRSVNTSALSGAGVIRLFNKVGETVNKIT--YKMDEN-------DPWF 245
            |..:..|..||.:     :.:|.....|   |.|..::||:|..:|  ||:...       ..:.
Human   193 LSFNEHFNIFLTA-----KDLNAYKKQG---IALLTRMGESVKHVTGGYKLRTRPLEFAAIGDYL 249

  Fly   246 DDKITEVESLDANLQKLHNAMKSLVTSRREL-------SLLTGLVAKSAAMLSTCEEHTGLSRAL 303
            |....::.::|...|::.......:...||.       |.|.|.:|:....:|.|..:  .|.||
Human   250 DTFALKLGTIDRIAQRIIKEEIEYLVELREYGPVYSTWSALEGELAEPLEGVSACIGN--CSTAL 312

  Fly   304 SNLAD--VEEKIELLRSEQANSDFFILAEFIKDYLGLFGAIKCIFHERVKAFQNWQYAQMQLSKR 366
            ..|.|  .|:.:.:||      ::.:.::.:|..|.....::..:..:::|          ::.|
Human   313 EELTDDMTEDFLPVLR------EYILYSDSMKSVLKKRDQVQAEYEAKLEA----------VALR 361

  Fly   367 RENRGRFELANRADKLDQAQQEVDEWQGKVQRCQQQFDDISAEIKREMERFELTRVKDFKVNIIK 431
            :|:|.:..    ||               |::||.:.:..:|::|.:|||::..:.:||:..:  
Human   362 KEDRPKVP----AD---------------VEKCQDRMECFNADLKADMERWQNNKRQDFRQLL-- 405

  Fly   432 YIEDQMAHQQQIVSYWE 448
                 |....:.:.|:|
Human   406 -----MGMADKNIQYYE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx1NP_608777.1 PX_SNX1_2_like 75..203 CDD:132769 42/129 (33%)
BAR_SNX1_2 232..455 CDD:153307 43/235 (18%)
SNX30XP_011516993.1 PX_SNX7_30_like 91..206 CDD:132770 43/136 (32%)
BAR_SNX30 190..418 CDD:153351 57/280 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5391
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D947320at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1659
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.