DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx1 and Snx6

DIOPT Version :9

Sequence 1:NP_608777.1 Gene:Snx1 / 33560 FlyBaseID:FBgn0031534 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster


Alignment Length:468 Identity:111/468 - (23%)
Similarity:196/468 - (41%) Gaps:68/468 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEVESPEHTRDFAEVDINNGAATGSEDEEEEVPAPGSVTLDRNESDLFVSALSPSSIGDIHPLQE 65
            ||:.||  |...|......||           |||...|   |.|.   ||.||.|.........
  Fly    22 MEIASP--TNPLATPPATGGA-----------PAPSGAT---NGSG---SATSPDSSSSAPATPA 67

  Fly    66 VLTDDGDYF-ISIVVSDPQKIGDGMGSYLAYKVTTKTNIPKFKRSEFSTLRRFSDFLGIHDLLVG 129
            ||.::..:. ||..:|:.:|:        .:.|.|:|.:|.|.:.:.:.:|:..:|:.:||.:..
  Fly    68 VLGENALHVEISDALSEKEKV--------KFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEE 124

  Fly   130 KYMRLGRIIPPAPSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALER--------------- 179
            .....|.||||.|.:....:::.|:.......|. ||:|..:..::.||.               
  Fly   125 NDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGN-MTKEEFKKMKSELEAEYLATFKKTVAMHEV 188

  Fly   180 FVHRTAQHPVLRVDLDFMNFLESDQEL---PRSVNTSALSGAGVIRLFNKVGETVNKITYK---M 238
            |:.|.|.|||.|||.....|||.||:|   ||  ...|:.|..|    ..:|:|.::|...   .
  Fly   189 FLRRLASHPVFRVDQHLKVFLEYDQDLCAKPR--KKMAIFGGFV----KSLGKTTDEILLSATVR 247

  Fly   239 DENDPWFDDKITEVESLDANLQKLHNAMKSLVTSRRELSLLTGLVAKSAAMLSTCEEHTGLSRAL 303
            |.|| :|::::..:.....:|::.....:.:....:::......::.:...|||.|: ..:...:
  Fly   248 DVND-FFENELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQKISNALTQLSTTEK-GNVETFV 310

  Fly   304 SNLADVEEKIELLRSEQANSDFFILAEFIKDYLGLFGAIKCIFHERVKAFQNWQYAQMQLSKRRE 368
            :..|::.|:|:.|.:..|:.....|.:.::.|.....|.|.:...|::....::.|...|.|.|.
  Fly   311 AKTAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCLAAYEAANRNLEKARS 375

  Fly   369 NRGRFELANRADKLDQAQQEVDEWQGKVQRCQQQFDDISAEIKREMERFELTRVKDFKVNIIKYI 433
            .          :|...|..||.|.:.......::|:.:||..|.|:..|...||..||.::::..
  Fly   376 K----------NKDVHAPLEVQEAETAQAEACEKFESMSACGKEELIGFRNRRVAAFKKSLVELS 430

  Fly   434 EDQMAHQQQIVSY 446
            |.::.|.:....|
  Fly   431 ELEIKHAKTQYEY 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx1NP_608777.1 PX_SNX1_2_like 75..203 CDD:132769 38/142 (27%)
BAR_SNX1_2 232..455 CDD:153307 42/218 (19%)
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 38/148 (26%)
BAR_SNX5_6 228..452 CDD:153305 45/232 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.