DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx1 and Snx8

DIOPT Version :9

Sequence 1:NP_608777.1 Gene:Snx1 / 33560 FlyBaseID:FBgn0031534 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001099382.1 Gene:Snx8 / 288504 RGDID:1305791 Length:463 Species:Rattus norvegicus


Alignment Length:433 Identity:97/433 - (22%)
Similarity:172/433 - (39%) Gaps:123/433 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AATGSEDEEEEVPAPG----SVTLDRNESDLFVSALSPSSI----GD----IHPLQEVLTDDGDY 73
            ||....|||.:.||.|    .||..||        |.|..:    |:    .:.|||:|..| ..
  Rat    17 AAEAEADEEADPPATGPQTSQVTEWRN--------LDPRRMQMPQGNPLLLSYTLQELLAKD-TV 72

  Fly    74 FISIVVSDPQKIGDGMGSYLAYKVTTKTNIPKFKRSEFSTLRRFSDFLGIHDLLVGKYMRLGRII 138
            .:.::   |:|.|..: .::.|:|:::    :||.|.:   ||::||:..|::|:.|:..  |::
  Rat    73 QVELI---PEKKGLFL-KHVEYEVSSQ----RFKSSVY---RRYNDFVVFHEVLLHKFPY--RMV 124

  Fly   139 PPAPSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALERFVHRTAQHPVLRVDL---DFMNFL 200
            |..|.|.::|:.:                |::|.||.||:||::..|:||....|:   .|::|.
  Rat   125 PALPPKRVLGADR----------------EFIEGRRRALKRFINLVARHPPFSEDVLLKLFLSFS 173

  Fly   201 ESDQE--------------------------LPRSVNTSALSGAGVIR----LFNKVGETVNKIT 235
            .||.:                          ||..:.|.......:||    .|.|:.:...:|.
  Rat   174 GSDVQHKLKEAAQCVGDEFTNCKLAARAKDFLPADIQTQFAMSRELIRNVYNSFYKLRDRAERIA 238

  Fly   236 YKMDENDP---WFDDKITEVE-SLDANL------QKLH-NAMKSLVTSRRELSLLTGLVAKSAAM 289
            .:..:|..   .|..::.:|. :|.::.      ..|| :...||..:.:.||:...|:|..||.
  Rat   239 SRAIDNAADLLIFGKELRQVTLALGSDTTPLPSWAALHLSTWGSLKQALKGLSVEFALLADKAAQ 303

  Fly   290 LSTCEEHTGLSRALSNLADVEEKIELLRSEQANSDFFILAEFIKDYLGLFGAIKCIFHERVKAFQ 354
            ....||:           ||.||:.|         |..|.:..||......  |.:.|:..:|..
  Rat   304 QGKKEEN-----------DVVEKLNL---------FLDLLQSYKDLCERHE--KGVLHKHQRALH 346

  Fly   355 NWQYAQMQLSKRRENRGRFELANRADKLDQAQQEVDEWQGKVQ 397
            .:...:.|:......|       ..:.::|.:..:.|.:..:|
  Rat   347 KYGLMKRQMMSAAHGR-------EPESVEQLESRIVEQENVIQ 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx1NP_608777.1 PX_SNX1_2_like 75..203 CDD:132769 34/130 (26%)
BAR_SNX1_2 232..455 CDD:153307 34/177 (19%)
Snx8NP_001099382.1 PX_SNX8_Mvp1p_like 70..173 CDD:132776 34/132 (26%)
BAR_SNX8 190..438 CDD:153281 41/222 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5391
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.