DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx1 and SNX33

DIOPT Version :9

Sequence 1:NP_608777.1 Gene:Snx1 / 33560 FlyBaseID:FBgn0031534 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_695003.1 Gene:SNX33 / 257364 HGNCID:28468 Length:574 Species:Homo sapiens


Alignment Length:390 Identity:87/390 - (22%)
Similarity:152/390 - (38%) Gaps:88/390 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VSDPQKIG--DGMGSYLAYKVT-TKTNIPKFKRSEFSTLRRFSDFLGIHDLLVGKYMRLGRIIPP 140
            |.||.|..  .|:.||::||:| |....|.:        ||:..|..:::.|:.|:..:.  :|.
Human   234 VEDPTKQTKFKGIKSYISYKLTPTHAASPVY--------RRYKHFDWLYNRLLHKFTVIS--VPH 288

  Fly   141 APSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALERFVHRTAQHPVLRVDLDFMNFLE--SD 203
            .|.|...|.               ..::::|.|:..|..::.....||||.....|.:||.  .|
Human   289 LPEKQATGR---------------FEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDD 338

  Fly   204 QEL---PRSVNTSALSGAGVIRLF-------------NKVGETVNKITYKMDENDPWFDDKITEV 252
            ::.   .|......:.||..:..|             ::| :|....:.||       ||.:.::
Human   339 KQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRV-DTFKAFSKKM-------DDSVLQL 395

  Fly   253 ESLDANLQKLHNAMKSLVTSRRELSLLTG---LVAKSAAM-LSTCEEHTGLSRALSNLADVEEKI 313
            .::.:.|.:.|     :...|:|...|..   .::.|..| ...|.|  .|:.|:|:.....|.|
Human   396 STVASELVRKH-----VGGFRKEFQKLGSAFQAISHSFQMDPPFCSE--ALNSAISHTGRTYEAI 453

  Fly   314 ELLRSEQANSDFFILAEFIKDYLGLFGAIKCIFHERVKAFQNWQYAQMQLSKRRENRGRFELANR 378
            ..:.:||..:|.|.:.:.:..|.||......|.|     .|...:|:::.|:|..:.||      
Human   454 GEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIH-----LQKGAFAKVKESQRMSDEGR------ 507

  Fly   379 ADKLDQAQQEVDEWQGKVQRCQQQFDDISAEIKREMERFELTRVKDFKVNIIKYIEDQMAHQQQI 443
                 ..|.|.|   |..:||:.    :...::.||..|...|..|||..:..|:..|:...|::
Human   508 -----MVQDEAD---GIRRRCRV----VGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRV 560

  Fly   444  443
            Human   561  560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx1NP_608777.1 PX_SNX1_2_like 75..203 CDD:132769 31/128 (24%)
BAR_SNX1_2 232..455 CDD:153307 49/216 (23%)
SNX33NP_695003.1 SH3_SNX33 4..58 CDD:212829
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..119
PX_domain 230..354 CDD:295365 33/144 (23%)
BAR_SNX33 365..571 CDD:153353 51/234 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1659
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.