DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx1 and snx-3

DIOPT Version :10

Sequence 1:NP_608777.1 Gene:Snx1 / 33560 FlyBaseID:FBgn0031534 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_492437.1 Gene:snx-3 / 189240 WormBaseID:WBGene00006503 Length:162 Species:Caenorhabditis elegans


Alignment Length:150 Identity:46/150 - (30%)
Similarity:78/150 - (52%) Gaps:25/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FISIVVSDPQKIGDGMGSYLAYKVTTKTNIPKFKRSEFSTLRRFSDFLGIHDLLVGKYMR--LGR 136
            |:.|.|.:|...|.|...|..|::..::|:|.||:.|.|..||:|||         :::|  |.|
 Worm    28 FLEIEVINPITHGVGKMRYTDYEIRMRSNLPVFKQKESSVRRRYSDF---------EWVRAELER 83

  Fly   137 ----IIPPAPSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALERFVHRTAQHPVLRVDLDFM 197
                ::|..|.|    |.|.:: |.:|:.|. ..:|::|.||.|||.|:::.|.||:.:.:....
 Worm    84 DSKIVVPTLPGK----SFKRQL-PFRSDDGI-FEEEFIENRRKALELFINKVAGHPLAQNERSLH 142

  Fly   198 NFLES---DQE-LPRSVNTS 213
            .||:.   |:. :|..:.|:
 Worm   143 IFLQEPTIDKNYVPGKIRTA 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx1NP_608777.1 PX_SNX1_2_like 75..203 CDD:132769 42/136 (31%)
BAR_SNX1_2 232..455 CDD:153307
snx-3NP_492437.1 PX_SNX3_like 28..150 CDD:132804 43/136 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.