DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2772 and YEH2

DIOPT Version :9

Sequence 1:NP_608776.1 Gene:CG2772 / 33559 FlyBaseID:FBgn0031533 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_013120.1 Gene:YEH2 / 850707 SGDID:S000004010 Length:538 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:60/180 - (33%)
Similarity:89/180 - (49%) Gaps:17/180 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EHGYPAESHFVETPDGYVLNVFRIPHSPKLNSNGNEGESEASRPVVLIMHGLFSCSDCFLLNGPE 105
            |:|...|...|||.||::::::.      ..|..|:|..|..|..:|::|||......|..:| .
Yeast   156 EYGIDIEEFEVETDDGFIIDLWH------FKSRLNDGVEEVKREPILLLHGLLQSCGAFASSG-R 213

  Fly   106 DALPYNYADAGYDVWLGNARGNIYSR-NNTRLNVKHPYFWKFSWHEIGSIDLPATIDYILAETGQ 169
            .:|.|...::|:||||||.|..:.:: |..:|...|...|.:..|::...||.|.|:|:|..||.
Yeast   214 KSLAYFLYESGFDVWLGNNRCGLNAKWNMKKLGNDHSKKWDWDMHQMVQYDLKALINYVLDSTGY 278

  Fly   170 QSLHYVGHSQGCTSFFVMG------SYRPEYNA--KIKTAHMLAPPVYMG 211
            ..|..|.||||.|..| ||      .|..::..  |::....|||.||.|
Yeast   279 AKLSLVAHSQGTTQGF-MGLVNGEKLYASDFKLVDKLENFVALAPAVYPG 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2772NP_608776.1 PLN02872 5..393 CDD:215470 60/180 (33%)
Abhydro_lipase 36..103 CDD:282003 18/61 (30%)
Abhydrolase 113..>196 CDD:304388 32/89 (36%)
YEH2NP_013120.1 PLN02872 163..>298 CDD:215470 49/142 (35%)
Abhydrolase 194..435 CDD:419691 47/136 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341618
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.