DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2772 and CG17097

DIOPT Version :9

Sequence 1:NP_608776.1 Gene:CG2772 / 33559 FlyBaseID:FBgn0031533 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster


Alignment Length:368 Identity:128/368 - (34%)
Similarity:192/368 - (52%) Gaps:14/368 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TSAERIAEHGYPAESHFVETPDGYVLNVFRIPHSPKLNSNGNEGESEASRPVVLIMHGLFSCSDC 98
            |:.:.|.::|||:|:::|.:.|||.|.:.|||.             ..:.||:|: |||.:.|..
  Fly   725 TTVDLIEKYGYPSETNYVTSEDGYRLCLHRIPR-------------PGAEPVLLV-HGLMASSAS 775

  Fly    99 FLLNGPEDALPYNYADAGYDVWLGNARGNIYSRNNTRLNVKHPYFWKFSWHEIGSIDLPATIDYI 163
            ::..||:|.|.|.....|||||:.|.|||||||.|....:|...:|.||:||||..|:||.||:|
  Fly   776 WVELGPKDGLAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKFDVPAAIDHI 840

  Fly   164 LAETGQQSLHYVGHSQGCTSFFVMGSYRPEYNAKIKTAHMLAPPVYMGNSTEGLIVSTAPLFGHH 228
            |..|.:..:.|:|||||.|.||||.|.||.|..|:.....|:|.||:..:...::.......|.:
  Fly   841 LIHTHKPKIQYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYLQENRSPVLKFLGMFKGKY 905

  Fly   229 GIGSTLLENQVLLPQNAFIQRVLDTTCSNQPIMLSYCKTLAILWGGPEIGNLNQTLLPQIAETHP 293
            .:...||....:..:...||:.....||...:..|.|.....:..|.:..:.|.||.|.:|....
  Fly   906 SMLLNLLGGYEISAKTKLIQQFRQHICSGSELGSSICAIFDFVLCGFDWKSFNTTLTPIVAAHAS 970

  Fly   294 AGVSSNQAIHYIQSYASNDFRLYDWGSKRNLEYYGVSEPPAYDLTKITSELYLYYGLADGSANKQ 358
            .|.|:.|..||.|.....:|:.:|.|:..|...|..||||||:|::.||::.|::|..|...:..
  Fly   971 QGASAKQIYHYAQLQGDLNFQRFDHGAVLNRVRYESSEPPAYNLSQTTSKVVLHHGEGDWLGSTS 1035

  Fly   359 DISRLPDLLPNLALLHEVPDSTWGHLDFIFATEVKRVINDLVL 401
            |:.||.:.||||....:|....:.|.||..:.:|:.::...||
  Fly  1036 DVIRLQERLPNLVESRKVNFEGFSHFDFTLSKDVRPLLYSHVL 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2772NP_608776.1 PLN02872 5..393 CDD:215470 125/358 (35%)
Abhydro_lipase 36..103 CDD:282003 20/66 (30%)
Abhydrolase 113..>196 CDD:304388 45/82 (55%)
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 20/67 (30%)
MhpC 746..1061 CDD:223669 115/328 (35%)
Abhydrolase_5 762..>899 CDD:289465 62/137 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439491
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.