DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and galnt10

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:NP_001070072.1 Gene:galnt10 / 767665 ZFINID:ZDB-GENE-030131-595 Length:261 Species:Danio rerio


Alignment Length:252 Identity:100/252 - (39%)
Similarity:136/252 - (53%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LKLNGIVALEE--TSQGLSGGTGGPGGRLPVAPSGR---------GTEVEYFNEAGYIRAGALRN 160
            |.|.|.|:||.  .::...||.|       :|...:         |...:.:::...||:.|.|.
Zfish    21 LLLLGSVSLERRLDAEEPEGGAG-------LAQMQKVNRKQVLKDGVRKKDWHDYAAIRSDAART 78

  Fly   161 G----------------EDPYIRNRFNQEASDALPSNRDIPDTRNPMCRTKKYREDLPETSVIIT 209
            |                :..|..|.||...||.:..||.:||.|:|.|:.|.|..|||.|||||.
Zfish    79 GAGEQGRPYPLTDAERVDQAYRENGFNIFVSDRIALNRSLPDIRHPNCKLKLYTADLPNTSVIIP 143

  Fly   210 FHNEARSTLLRTIVSVLNRSPEHLIREIVLVDDYSD--HPEDGLE--LAKIDKVRVIRNDKREGL 270
            ||||..|:||||:.|||:|||..||.||:||||:||  |.:..||  :.::.|||::|..|||||
Zfish   144 FHNEGWSSLLRTVHSVLDRSPPSLIAEIILVDDFSDKGHLKAPLEQYMVRLPKVRILRTQKREGL 208

  Fly   271 VRSRVKGADAAVSSVLTFLDSHVECNEMWLEPLLERVREDPTRVVCPVIDVISMDNF 327
            :|:|:.||.||...|:||||||.|.|..||.|||:|:.::....|        :|:|
Zfish   209 IRTRLLGAAAARGQVITFLDSHCEANVNWLPPLLDRIAQNTNSSV--------LDSF 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 69/132 (52%)
pp-GalNAc-T 205..500 CDD:133004 65/127 (51%)
Ricin_B_lectin 511..627 CDD:279046
RICIN 513..629 CDD:238092
galnt10NP_001070072.1 WcaA 134..>260 CDD:223539 69/132 (52%)
Glyco_tranf_GTA_type 139..>253 CDD:299700 62/113 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.