DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and GALNT17

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:NP_071924.1 Gene:GALNT17 / 64409 HGNCID:16347 Length:598 Species:Homo sapiens


Alignment Length:550 Identity:200/550 - (36%)
Similarity:292/550 - (53%) Gaps:63/550 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 KLNGIVALEETSQGLSGGTGGPG-GRLPVAPSGRGTEVEYFNEAGYIRAGALRNGEDPYIRNRFN 171
            :|||:    ..|.||..|.||.| |.||...|....|                ..:.|:.:..:|
Human    77 QLNGL----SKSLGLIEGYGGRGKGGLPATLSPAEEE----------------KAKGPHEKYGYN 121

  Fly   172 QEASDALPSNRDIPDTRNPMCRTKKYREDLPETSVIITFHNEARSTLLRTIVSVLNRSPEHLIRE 236
            ...|:.:..:|.|||.|...|:..||.:|||:.|:|..|.|||.|.:||::.|.:|.:|.||::|
Human   122 SYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTPTHLLKE 186

  Fly   237 IVLVDDYSDHPEDGLELAK-IDK-----VRVIRNDKREGLVRSRVKGADAAVSSVLTFLDSHVEC 295
            |:||||.||..|..:.|.: :.|     |:|:||.|||||:|:|::|...|...|..|.|:|||.
Human   187 IILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQVTGFFDAHVEF 251

  Fly   296 NEMWLEPLLERVREDPTRVVCPVIDVISMDNFQYIGASADLRGGFDWNLIFKW-EYLSPSERAMR 359
            ...|.||:|.|::|:..||:.|.||.|..|||: :....:...|:.|.|   | .|:||.:....
Human   252 TAGWAEPVLSRIQENRKRVILPSIDNIKQDNFE-VQRYENSAHGYSWEL---WCMYISPPKDWWD 312

  Fly   360 HNDPTTAIRTPMIAGGLFVIDKAYFNKLGKYDMKMDVWGGENLEISFRVWQCGGSLEIIPCSRVG 424
            ..||:..||||.:.|..||:::.:|.::|..|..|||:||||:|:..:||.||||:|::|||||.
Human   313 AGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLCGGSMEVLPCSRVA 377

  Fly   425 HVFRKRHPYTFPGGSGNVFARNTRRAAEVWMDDYKQHYYNA--VPLAK-NIPFGNIDDRLALKEK 486
            |:.||:.||.  ...|....||..|.|||||||||.|.|.|  :||.. .|..|::.:|.||::.
Human   378 HIERKKKPYN--SNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLPLENPGIDIGDVSERRALRKS 440

  Fly   487 LHCKPFKWYLENVYPDLQA-PDPQEVGQFRQDSTE--CLDTMGHLIDGTVGIFPCHNTGGNQEWA 548
            |.||.|:|||::|||:::. .:....|:.|.:..:  ||| .|.|.:.|..::|||. .|.|...
Human   441 LKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD-QGPLENHTAILYPCHG-WGPQLAR 503

  Fly   549 FTKRG----------EIKHDDLCLTLVTFARGSQVVLKACD---DSENQRWIMREGGLVRHYKIN 600
            :||.|          .:..|..||...:.:|..|  |..||   .|..:||...:.|.:.:....
Human   504 YTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQ--LLDCDKVKSSLYKRWNFIQNGAIMNKGTG 566

  Fly   601 VCLDSRDQSQQGVS--AQHCNSALGTQRWS 628
            .||:..::...|:.  .:.|..    |||:
Human   567 RCLEVENRGLAGIDLILRSCTG----QRWT 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 104/238 (44%)
pp-GalNAc-T 205..500 CDD:133004 133/304 (44%)
Ricin_B_lectin 511..627 CDD:279046 33/132 (25%)
RICIN 513..629 CDD:238092 34/132 (26%)
GALNT17NP_071924.1 Catalytic subdomain A 151..262 50/110 (45%)
pp-GalNAc-T 155..454 CDD:133004 133/304 (44%)
Catalytic subdomain B 319..381 31/61 (51%)
RICIN 467..593 CDD:238092 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.