DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and Galntl5

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:NP_001020319.1 Gene:Galntl5 / 499968 RGDID:1565271 Length:443 Species:Rattus norvegicus


Alignment Length:355 Identity:162/355 - (45%)
Similarity:228/355 - (64%) Gaps:20/355 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 DPYI-----RNRFNQEASDALPSNRDIPDTRNPMCRTKKYREDLPETSVIITFHNEARSTLLRTI 222
            ||.:     |...|...|..|...|.:||:||.:|:.|.|..:||..||||.|:||..:|||||:
  Rat    76 DPELIQGLSRYGLNVITSRRLGIERQVPDSRNKICQQKHYPFNLPTASVIICFYNEEFNTLLRTV 140

  Fly   223 VSVLNRSPEHLIREIVLVDDYSDHPEDGLELAKID--------KVRVIRNDKREGLVRSRVKGAD 279
            .||:|.||:||:.||:||||.|:.  |.|: ||:|        |::::||.|||||:|||:.||.
  Rat   141 SSVMNLSPKHLLEEIILVDDMSEF--DDLK-AKLDYHLEIFRGKIKLVRNKKREGLIRSRMIGAS 202

  Fly   280 AAVSSVLTFLDSHVECNEMWLEPLLERVREDPTRVVCPVIDVISMDNFQYIGASADLRGGFDWNL 344
            .|...:|.|||||.|.|.:||||||..:.:|...|||||||||......|:| |..:||.|||||
  Rat   203 RASGDILVFLDSHCEVNRVWLEPLLHAIAKDHKMVVCPVIDVIDELTLDYVG-SPIVRGAFDWNL 266

  Fly   345 IFKWEYLSPSERAMRHNDPTTAIRTPMIAGGLFVIDKAYFNKLGKYDMKMDVWGGENLEISFRVW 409
            .|:|:.:. |........|:|.||:|.::||:|.|::.|||:||:||..||:|||||:|:|.|:|
  Rat   267 NFRWDDVF-SYELDGPEGPSTPIRSPAMSGGIFAINRHYFNELGQYDKDMDLWGGENVELSLRIW 330

  Fly   410 QCGGSLEIIPCSRVGHVFRKRHPYTFPGGSGNVFARNTRRAAEVWMDDYKQHYYNAVPLAKNIPF 474
            .|||.|.|:|||||||..:..........|  ..::|..|...||:|:||::::...|...::..
  Rat   331 MCGGQLFILPCSRVGHNNKALSKNRLVNQS--ALSKNLLRVVHVWLDEYKENFFLQRPSLTHVSC 393

  Fly   475 GNIDDRLALKEKLHCKPFKWYLENVYPDLQ 504
            |||.||:.|:::|.||.|:|||:|::|:|:
  Rat   394 GNISDRVELRKRLGCKSFQWYLDNIFPELE 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 123/239 (51%)
pp-GalNAc-T 205..500 CDD:133004 144/302 (48%)
Ricin_B_lectin 511..627 CDD:279046
RICIN 513..629 CDD:238092
Galntl5NP_001020319.1 pp-GalNAc-T 123..419 CDD:133004 144/302 (48%)
Glyco_tranf_2_3 123..355 CDD:290369 121/236 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.