DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and Pgant6

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:NP_001261342.1 Gene:Pgant6 / 38346 FlyBaseID:FBgn0035375 Length:666 Species:Drosophila melanogaster


Alignment Length:524 Identity:185/524 - (35%)
Similarity:274/524 - (52%) Gaps:87/524 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 RLPVAPSGRGTEVEYFNEAGYIRAGALRNGEDPYIRNRFNQEASDALPSNRDIPDTRNPMCRTKK 196
            |:.:...|:.:.::..::....:..:|.||        ||...||::..||.:||.|:|:||.|:
  Fly   140 RVGLGEGGKASTLDDESQRDLEKRMSLENG--------FNALLSDSISVNRSVPDIRHPLCRKKE 196

  Fly   197 YREDLPETSVIITFHNEARSTLLRTIVSVLNRSPEHLIREIVLVDDYSDHPEDGLEL----AKID 257
            |...||..||||.|:||..|.|:|::.|::||||..|::||:||||:||....|.||    |:..
  Fly   197 YVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHF 261

  Fly   258 K-VRVIRNDKREGLVRSRVKGADAAVSSVLTFLDSHVECNEMWLEPLLERVREDPTRVVCPVIDV 321
            | |||:|..:|.||:.:|..||..|.:.||.|||||||.|..||.||||.:..:....|||.|||
  Fly   262 KWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDV 326

  Fly   322 ISMDNFQYIGASADLRGGFDWNLIFKWEYLSPSERAMRHNDPTTAIRTPMIAGGLFVIDKAYFNK 386
            |...||.|.......||.|||...:|...|.|.:  ::|  |....::|::|||||.|.:.:|.:
  Fly   327 IDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPED--LKH--PADPFKSPIMAGGLFAISREFFWE 387

  Fly   387 LGKYDMKMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKRHPYTFPGGSGNVFARNTRRAA 451
            ||.||..:|:||||..|:||::|.|||.:...||||:||::|....:......|:...:|.:|.|
  Fly   388 LGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLHKNYKRVA 452

  Fly   452 EVWMDDYKQHYY-NAVPLAKNIPFGNIDDRLALKEKLHCKPFKWYLENV-------YPDLQAPD- 507
            |||||:||.:.| :...|.:::..|::.::.|::.||:||.|||::|.|       ||.:..|. 
  Fly   453 EVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSY 517

  Fly   508 ----PQEVGQFRQDSTECLDTMGHLIDGTVGIF-------------------------------- 536
                .|.||    :...||||:|......:|::                                
  Fly   518 AMGALQNVG----NQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECL 578

  Fly   537 --------------PCHNTGGNQEWAFTKR-GEIKHDD---LCLTLVTFARGSQVVLKACD-DSE 582
                          .||:.||||.|.:..| .::||..   .||.|:.|::  :||...|| |:.
  Fly   579 DVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELLPFSQ--EVVANKCDTDNR 641

  Fly   583 NQRW 586
            .|:|
  Fly   642 FQQW 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 109/236 (46%)
pp-GalNAc-T 205..500 CDD:133004 131/307 (43%)
Ricin_B_lectin 511..627 CDD:279046 29/127 (23%)
RICIN 513..629 CDD:238092 27/125 (22%)
Pgant6NP_001261342.1 BcsA 199..>413 CDD:224136 99/217 (46%)
pp-GalNAc-T 205..502 CDD:133004 130/300 (43%)
RICIN 520..647 CDD:238092 30/132 (23%)
Ricin_B_lectin 520..645 CDD:279046 29/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457055
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D60373at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.