DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and Galnt3

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:NP_001015032.2 Gene:Galnt3 / 366061 RGDID:1306443 Length:633 Species:Rattus norvegicus


Alignment Length:500 Identity:212/500 - (42%)
Similarity:293/500 - (58%) Gaps:56/500 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 FNQEASDALPSNRDI-PDTRNPMCRTKKYRE--DLPETSVIITFHNEARSTLLRTIVSVLNRSPE 231
            ||..|||.:..:||: ||||.|.|..:|::.  .||.|||||.|||||.||||||:.|||..||.
  Rat   150 FNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPA 214

  Fly   232 HLIREIVLVDDYS--DHPEDGLE--LAKIDKVRVIRNDKREGLVRSRVKGADAAVSSVLTFLDSH 292
            .|::||:||||.|  |:..:.||  :.:...|:::|..:|:||:.:|:.||..|.:..|||||:|
  Rat   215 ILLKEIILVDDASVDDYLHEKLEEYIKQFSIVKIVRQQERKGLITARLLGAAVATAETLTFLDAH 279

  Fly   293 VECNEMWLEPLLERVREDPTRVVCPVIDVISMDNFQY-----IGASADLRGGFDWNLIFKWEYLS 352
            .||...||||||.|:.|:.|.||.|.|..|.::.|::     .|::.: ||.|||:|.|.||.| 
  Rat   280 CECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNKPSPYGSNHN-RGNFDWSLSFGWESL- 342

  Fly   353 PSERAMRHNDPTTAIRTPMIAGGLFVIDKAYFNKLGKYDMKMDVWGGENLEISFRVWQCGGSLEI 417
            |.....|..|.|..|:||..|||||.|.:.||..:|.||.:|::|||||:|:|||||||||.|||
  Rat   343 PDHEKQRRKDETYPIKTPTFAGGLFSISRDYFEHIGSYDEEMEIWGGENIEMSFRVWQCGGQLEI 407

  Fly   418 IPCSRVGHVFRKRHPYTFPGGSGNVFARNTRRAAEVWMDDYKQHYY----NAVPLAKNIPFGNID 478
            :|||.||||||.:.|:|||.|: .|.|||..|.||||||:||:.:|    :|..:.|...||::.
  Rat   408 MPCSVVGHVFRSKSPHTFPKGT-QVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKSFGDLS 471

  Fly   479 DRLALKEKLHCKPFKWYLENVYPDLQAPD--P------QEVGQFRQDSTECLD----TMGHLIDG 531
            .|..:|::|.||.|.|||..:||::..||  |      :.|||     ..|||    ..|   |.
  Rat   472 KRFEIKKRLQCKNFTWYLNTIYPEVYVPDLNPVISGYIKSVGQ-----PLCLDVGENNQG---DK 528

  Fly   532 TVGIFPCHNTGGNQEWAFTKRGEIKHD---DLCLTLVTFARGSQVVLKACDDSEN-------QRW 586
            .:.::.||..||||.:.::.:.||:|:   :|||    .|....|.||||....:       |.|
  Rat   529 PLILYTCHGLGGNQYFEYSAQREIRHNIQKELCL----HATQGVVQLKACVYKGHRTIAPGEQIW 589

  Fly   587 IMREGGLVRHYKINVCLDSRDQSQQGVSAQHCNSALGTQRWSFGK 631
            .:|:..|:.:....:||.|..:..   |...|::....|:|.|.:
  Rat   590 EIRKDQLLYNPLFRMCLSSNGEHP---SLVPCDTTDLLQKWIFSQ 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 123/240 (51%)
pp-GalNAc-T 205..500 CDD:133004 152/307 (50%)
Ricin_B_lectin 511..627 CDD:279046 36/129 (28%)
RICIN 513..629 CDD:238092 35/129 (27%)
Galnt3NP_001015032.2 pp-GalNAc-T 188..493 CDD:133004 152/307 (50%)
Ricin_B_lectin 506..627 CDD:279046 36/135 (27%)
RICIN 507..629 CDD:238092 37/136 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.