DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and CG31776

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:NP_722909.2 Gene:CG31776 / 33568 FlyBaseID:FBgn0051776 Length:630 Species:Drosophila melanogaster


Alignment Length:506 Identity:175/506 - (34%)
Similarity:251/506 - (49%) Gaps:81/506 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RAGALRNGE-DPYIRNRFNQEASDALPSNRDIPDTRNPMCRTKKYREDLPETSVIITFHNEARST 217
            ||..|.|.: :|.....|..|.||.:|.||.:||||...||.:||.|:||..:|||.||:|..|.
  Fly   118 RAVQLPNAKLNPDDFQDFYAELSDRIPLNRSLPDTRPISCRKRKYLENLPNVTVIIAFHDEHLSV 182

  Fly   218 LLRTIVSVLNRSPEHLIREIVLVDDYSDHPEDGLELAKI------DKVRVIRNDKREGLVRSRVK 276
            |||:|.|::||||..|:::||||||.|:.||.|.:|.:|      ..:.::|..:|.|.:::|::
  Fly   183 LLRSITSIINRSPVELLKQIVLVDDDSNLPELGQQLEEIVAQNFPKIIHILRLPERRGSIKARME 247

  Fly   277 GADAAVSSVLTFLDSHVECNEMWLEPLLERVREDPTRVVCPVIDVISMDNFQYIGASADLRGGFD 341
            ....:...||.|||||:|.|..||.||||.:..:|..|..|::|.||...|.|...:...|.||:
  Fly   248 AIRVSSCQVLVFLDSHIEVNTNWLPPLLEPIVINPHIVTRPILDAISRKTFAYAKQNTMTRSGFN 312

  Fly   342 WNLIFKWEYLSPSERAMRHNDPTTAIRTPMIAGGLFVIDKAYFNKLGKYDMKMDVWGGENLEISF 406
            |.|..:...:.|.::    :..:|..|||:::|.: .||:.||..||.:|.::|.|..|..||||
  Fly   313 WWLESESLPIFPEDK----SPDSTPYRTPVLSGAM-AIDRNYFLNLGGFDEQLDTWEAEKFEISF 372

  Fly   407 RVWQCGGSLEIIPCSRVGHVFRKRHPYTFPGGSGNVFARNTRRAAEVWMDDYKQHYYNAVP-LAK 470
            :||.|||.:..:||:||||:.::........|..|..|||.:|.||||||:||::.|:..| |.|
  Fly   373 KVWMCGGMMLYVPCARVGHIGKRPMKSISSPGYHNFLARNYKRVAEVWMDNYKKYVYDKNPKLYK 437

  Fly   471 NIPFGNIDDRLALKEKLHCKPFKWYLENVYPD-------LQAP---------------------- 506
            ....|.:..|...:..|.||.|.||:..|.||       |.:|                      
  Fly   438 MANAGLLFQRKTKRNALECKTFDWYMTKVAPDFLKRYLALDSPLVFSGVIESVAFPGFCVDSLNC 502

  Fly   507 ---------------------------DPQEVGQFRQDSTECLDTMGHLIDGTVGIFPCHNTGGN 544
                                       ...|: |......:||:..| |...:|.:|.||..|||
  Fly   503 RHTKPVVLARCTGHNSMPGEHQNWSLTQDHEI-QLTNSKDDCLEAQG-LRSKSVWLFRCHKNGGN 565

  Fly   545 QEWAFTKRGE-IKHDDL---CLTLVTFARGSQV--VL--KACDDSE-NQRW 586
            |.|.:..|.. |:...:   ||. ...|.|.:|  ||  |.||.:: .|:|
  Fly   566 QYWYYNHRHRWIQQGQIWVWCLE-AQLASGHKVGKVLANKICDKNQLEQQW 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 94/237 (40%)
pp-GalNAc-T 205..500 CDD:133004 118/301 (39%)
Ricin_B_lectin 511..627 CDD:279046 28/85 (33%)
RICIN 513..629 CDD:238092 28/83 (34%)
CG31776NP_722909.2 GT2 167..495 CDD:224137 124/332 (37%)
pp-GalNAc-T 170..467 CDD:133004 118/301 (39%)
Ricin_B_lectin 483..615 CDD:279046 28/134 (21%)
RICIN 485..616 CDD:238092 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457053
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D60373at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.