DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and GALNT3

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:NP_004473.2 Gene:GALNT3 / 2591 HGNCID:4125 Length:633 Species:Homo sapiens


Alignment Length:494 Identity:211/494 - (42%)
Similarity:294/494 - (59%) Gaps:52/494 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 FNQEASDALPSNRDI-PDTRNPMCRTKKYRE--DLPETSVIITFHNEARSTLLRTIVSVLNRSPE 231
            ||..|||.:..:||: ||||.|.|..:|::.  .||.|||||.|||||.||||||:.|||..||.
Human   150 FNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPA 214

  Fly   232 HLIREIVLVDDYS--DHPEDGLE--LAKIDKVRVIRNDKREGLVRSRVKGADAAVSSVLTFLDSH 292
            .|::||:||||.|  ::..|.|:  :.:...|:::|..:|:||:.:|:.||..|.:..|||||:|
Human   215 ILLKEIILVDDASVDEYLHDKLDEYVKQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAH 279

  Fly   293 VECNEMWLEPLLERVREDPTRVVCPVIDVISMDNFQY-----IGASADLRGGFDWNLIFKWEYLS 352
            .||...||||||.|:.|:.|.||.|.|..|.::.|::     .|::.: ||.|||:|.|.||.| 
Human   280 CECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNKPSPYGSNHN-RGNFDWSLSFGWESL- 342

  Fly   353 PSERAMRHNDPTTAIRTPMIAGGLFVIDKAYFNKLGKYDMKMDVWGGENLEISFRVWQCGGSLEI 417
            |.....|..|.|..|:||..|||||.|.|.||..:|.||.:|::|||||:|:|||||||||.|||
Human   343 PDHEKQRRKDETYPIKTPTFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEI 407

  Fly   418 IPCSRVGHVFRKRHPYTFPGGSGNVFARNTRRAAEVWMDDYKQHYY----NAVPLAKNIPFGNID 478
            :|||.||||||.:.|::||.|: .|.|||..|.||||||:||:.:|    :|..:.|...||::.
Human   408 MPCSVVGHVFRSKSPHSFPKGT-QVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLS 471

  Fly   479 DRLALKEKLHCKPFKWYLENVYPDLQAPD--P------QEVGQFRQDSTECLDTMGHLIDG--TV 533
            .|..:|.:|.||.|.|||.|:||::..||  |      :.|||     ..||| :|....|  .:
Human   472 KRFEIKHRLQCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQ-----PLCLD-VGENNQGGKPL 530

  Fly   534 GIFPCHNTGGNQEWAFTKRGEIKHD---DLCLTLVTFARGSQVVLKACD-------DSENQRWIM 588
            .::.||..||||.:.::.:.||:|:   :|||    .|....|.||||.       .:..|.|.:
Human   531 IMYTCHGLGGNQYFEYSAQHEIRHNIQKELCL----HAAQGLVQLKACTYKGHKTVVTGEQIWEI 591

  Fly   589 REGGLVRHYKINVCLDSRDQSQQGVSAQHCNSALGTQRW 627
            ::..|:.:..:.:||.:..:....||   ||.:...|:|
Human   592 QKDQLLYNPFLKMCLSANGEHPSLVS---CNPSDPLQKW 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 123/240 (51%)
pp-GalNAc-T 205..500 CDD:133004 152/307 (50%)
Ricin_B_lectin 511..627 CDD:279046 36/127 (28%)
RICIN 513..629 CDD:238092 35/127 (28%)
GALNT3NP_004473.2 Catalytic subdomain A 184..293 56/108 (52%)
pp-GalNAc-T 188..493 CDD:133004 152/307 (50%)
Catalytic subdomain B 356..418 41/61 (67%)
Ricin_B_lectin 506..627 CDD:306998 36/133 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.