DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and GALNT1

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:NP_001371367.1 Gene:GALNT1 / 2589 HGNCID:4123 Length:559 Species:Homo sapiens


Alignment Length:533 Identity:242/533 - (45%)
Similarity:319/533 - (59%) Gaps:41/533 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 EETSQGLSGGT---------GGPG--GRLPVAPSGRGTEVEYFNEAGYIRAGALRNGEDPYIRNR 169
            |:..:||..|.         .|||  |:..|.|.   .:.|...|...|              |:
Human    36 EKKERGLPAGDVLEPVQKPHEGPGEMGKPVVIPK---EDQEKMKEMFKI--------------NQ 83

  Fly   170 FNQEASDALPSNRDIPDTRNPMCRTKKYREDLPETSVIITFHNEARSTLLRTIVSVLNRSPEHLI 234
            ||..||:.:..||.:||.|...|:||.|.::||.|||:|.|||||.||||||:.||:||||.|:|
Human    84 FNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMI 148

  Fly   235 REIVLVDDYSDHP------EDGLELAKIDKVRVIRNDKREGLVRSRVKGADAAVSSVLTFLDSHV 293
            .|||||||.|:..      |..::..|: .|.|||.::|.||:|:|:|||..:...|:||||:|.
Human   149 EEIVLVDDASERDFLKRPLESYVKKLKV-PVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHC 212

  Fly   294 ECNEMWLEPLLERVREDPTRVVCPVIDVISMDNFQYIGASADLRGGFDWNLIFKWEYLSPSERAM 358
            ||...||||||.|::.|...||||:|||||.|.|:|:..|....|||:|.|.|:|..:...|...
Human   213 ECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDR 277

  Fly   359 RHNDPTTAIRTPMIAGGLFVIDKAYFNKLGKYDMKMDVWGGENLEISFRVWQCGGSLEIIPCSRV 423
            |..|.|..:|||.:|||||.||:.||.::|.||..||:|||||||||||:|||||:|||:.||.|
Human   278 RKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHV 342

  Fly   424 GHVFRKRHPYTFPGGSGNVFARNTRRAAEVWMDDYKQHYYNAVPLAKNIPFGNIDDRLALKEKLH 488
            ||||||..|||||||:|.:..:|.||.||||||::|..:|...|....:.:|:|..|:.|:.||.
Human   343 GHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQ 407

  Fly   489 CKPFKWYLENVYPDLQAPDPQ-EVGQFRQ-DSTECLDTMGHLIDGTVGIFPCHNTGGNQEWAFTK 551
            ||||.|||||:|||.|.|... .:|:.|. ::.:|||.|....:..||||.||..||||.:::|.
Human   408 CKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTA 472

  Fly   552 RGEIKHDDLCLTLVTFARGSQVVLKACDDSENQRWIMREGGL-VRHYKINVCLD-SRDQSQQGVS 614
            ..||:.|||||. |:...|...:||......||.|......| ::|...|.||| :.::..|..|
Human   473 NKEIRTDDLCLD-VSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPS 536

  Fly   615 AQHCNSALGTQRW 627
            .:.||.: .:|:|
Human   537 IRDCNGS-RSQQW 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 132/237 (56%)
pp-GalNAc-T 205..500 CDD:133004 164/300 (55%)
Ricin_B_lectin 511..627 CDD:279046 42/118 (36%)
RICIN 513..629 CDD:238092 42/118 (36%)
GALNT1NP_001371367.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..65 5/19 (26%)
Catalytic subdomain A 115..225 61/110 (55%)
pp-GalNAc-T 119..419 CDD:133004 164/300 (55%)
Catalytic subdomain B 285..347 42/61 (69%)
Ricin_B_lectin 432..548 CDD:395527 42/117 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.