DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and Galnt18

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:NP_776100.2 Gene:Galnt18 / 233733 MGIID:2446239 Length:622 Species:Mus musculus


Alignment Length:545 Identity:186/545 - (34%)
Similarity:279/545 - (51%) Gaps:88/545 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VAPSGRGTEVEYFNEAGYIRAGALRNGEDPYIRNRFNQEASDALPSNRDIPDTRNPMCRTKKYRE 199
            ::|.||...::.|...||                  |...||.||.:|.:||.|...||...:.:
Mouse   105 LSPEGRRVALKQFQYYGY------------------NAYLSDRLPLDRPLPDLRPSGCRNLSFPD 151

  Fly   200 DLPETSVIITFHNEARSTLLRTIVSVLNRSPEHLIREIVLVDDYSDHPEDGLELAK-IDKV---- 259
            .|||.|::..|.|||.|.|||:|.|.:.|:|.||::||:||||.|.:.|...:|.: :|||    
Mouse   152 SLPEVSIVFIFVNEALSVLLRSIHSAMERTPSHLLKEIILVDDNSSNEELKEKLTEYVDKVNGQK 216

  Fly   260 ----RVIRNDKREGLVRSRVKGADAAVSSVLTFLDSHVECNEMWLEPLLERVREDPTRVVCPVID 320
                :|:|:.|:|||:||||.|..||.:.|:...|:|||.|..|.||:|.|::|:..|::.|..|
Mouse   217 PGFIKVVRHSKQEGLIRSRVSGWRAATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFD 281

  Fly   321 VISMDNF---QYIGASADLRGGFDWNLIFKW-EYLSPSERAMRHNDPTTAIRTPMIAGGLFVIDK 381
            .|..|||   :|..|:.    ||||.|   | .||:|.:...:..:.|..||:|.:. |.|::|:
Mouse   282 NIKYDNFEIEEYPLAAQ----GFDWEL---WCRYLNPPKAWWKLENSTAPIRSPALI-GCFIVDR 338

  Fly   382 AYFNKLGKYDMKMDVWGGENLEISFR---------------VWQCGGSLEIIPCSRVGHVFRKRH 431
            .||.::|..|..|:|:||||:|:..|               |||||||:|::||||:.|:.|...
Mouse   339 QYFEEIGLLDEGMEVYGGENVELGIRVSEISHTGLSSAPMMVWQCGGSVEVLPCSRIAHIERAHK 403

  Fly   432 PYTFPGGSGNVFARNTRRAAEVWMDDYKQHYYNAVPLAKNIP-------FGNIDDRLALKEKLHC 489
            ||| ...:.:| .||..|.||||||::|.|.|    :|.|||       .|:|..|.||:::|.|
Mouse   404 PYT-EDLTAHV-RRNALRVAEVWMDEFKSHVY----MAWNIPQEDSGIDIGDITARKALRKQLQC 462

  Fly   490 KPFKWYLENVYPDLQAPDPQEVGQFRQDSTE---CLDTMGHLIDGTVGIFPCHN-TGGNQEWAFT 550
            |.|:|||.:|||:::...........|:|.:   ||| .|...:....::.||. |..|..:..:
Mouse   463 KTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTDLCLD-QGPDTENVPIVYICHGMTPQNVYYTSS 526

  Fly   551 KRGEI--------KHDDLCLTLVTFARGSQVVLKACDDSENQR----WIMREGGLVRHYKINVCL 603
            ::..:        ..|:.||..|    .|:..|..|..::.:|    |...:||.:::.|...||
Mouse   527 QQIHVGILSPTVDDDDNRCLVDV----NSRPRLIECSYAKAKRMKLHWQFSQGGSIQNRKSKRCL 587

  Fly   604 DSRDQSQQGVSAQHCNSALGTQRWS 628
            :.::.|......|........|.|:
Mouse   588 ELQENSDMEFGFQLVLQKCSGQHWT 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 106/259 (41%)
pp-GalNAc-T 205..500 CDD:133004 135/329 (41%)
Ricin_B_lectin 511..627 CDD:279046 27/131 (21%)
RICIN 513..629 CDD:238092 28/132 (21%)
Galnt18NP_776100.2 Catalytic subdomain A 153..267 53/113 (47%)
pp-GalNAc-T 157..473 CDD:133004 135/329 (41%)
Catalytic subdomain B 324..400 31/76 (41%)
Ricin_B_lectin 484..611 CDD:279046 27/131 (21%)
RICIN 486..613 CDD:238092 28/132 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.