DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and GALNTL5

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:XP_016867282.1 Gene:GALNTL5 / 168391 HGNCID:21725 Length:496 Species:Homo sapiens


Alignment Length:383 Identity:165/383 - (43%)
Similarity:230/383 - (60%) Gaps:35/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 APSGRGTEVEYFNEAGYIRAGALRNGEDPYIRNRFNQEASDALPSNRDIPDTRNPMCRTKKYRED 200
            |.|..||:..:.|..  :....|:.|        ||...|.:|...|::||||:.||..|.|...
Human   131 AKSMLGTDFNHTNPE--LHKELLKYG--------FNVIISRSLGIEREVPDTRSKMCLQKHYPAR 185

  Fly   201 LPETSVIITFHNEARSTLLRTIVSVLNRSPEHLIREIVLVDDYSDHPEDGLELAKID-------- 257
            ||..|::|.|:||..:.|.:|:.||.|.:|.:.:.||:||||.|  ..|.|: .|:|        
Human   186 LPTASIVICFYNEECNALFQTMSSVTNLTPHYFLEEIILVDDMS--KVDDLK-EKLDYHLETFRG 247

  Fly   258 KVRVIRNDKREGLVRSRVKGADAAVSSVLTFLDSHVECNEMWLEPLLERVREDPTRVVCPVIDVI 322
            ||::|||.|||||:|:|:.||..|...||.|||||.|.|.:||||||..:.:||..||||:||||
Human   248 KVKIIRNKKREGLIRARLIGASHASGDVLVFLDSHCEVNRVWLEPLLHAIAKDPKMVVCPLIDVI 312

  Fly   323 SMDNFQYIGASADLRGGFDWNLIFKWEYLSPSERAMRHNDP---TTAIRTPMIAGGLFVIDKAYF 384
            .....:| ..|..:||.|||||.|||:.:...|.    :.|   |..||:|.::||:|.|.:.||
Human   313 DDRTLEY-KPSPLVRGTFDWNLQFKWDNVFSYEM----DGPEGSTKPIRSPAMSGGIFAIRRHYF 372

  Fly   385 NKLGKYDMKMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKR--HPYTFPGGSGNVFARNT 447
            |::|:||..||.||.||||:|.|:|.|||.|.|||||||||:.:|:  .|.|..    :....|.
Human   373 NEIGQYDKDMDFWGRENLELSLRIWMCGGQLFIIPCSRVGHISKKQTGKPSTII----SAMTHNY 433

  Fly   448 RRAAEVWMDDYKQHYYNAVPLAKNIPFGNIDDRLALKEKLHCKPFKWYLENVYPDLQA 505
            .|...||:|:||:.::...|..|.:.:|||.:|:.|:::|.||.|:|||:||:|:|:|
Human   434 LRLVHVWLDEYKEQFFLRKPGLKYVTYGNIRERVELRKRLGCKSFQWYLDNVFPELEA 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 117/244 (48%)
pp-GalNAc-T 205..500 CDD:133004 139/307 (45%)
Ricin_B_lectin 511..627 CDD:279046
RICIN 513..629 CDD:238092
GALNTL5XP_016867282.1 GT2 187..437 CDD:224137 120/261 (46%)
pp-GalNAc-T 190..486 CDD:133004 139/307 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.