DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and GALNT5

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:XP_016858726.1 Gene:GALNT5 / 11227 HGNCID:4127 Length:956 Species:Homo sapiens


Alignment Length:548 Identity:214/548 - (39%)
Similarity:303/548 - (55%) Gaps:76/548 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PG--GRLPVAPSGRGTEVEYFNEAGYIRAGALRNGEDPYIRNRFNQEASDALPSNRDIPDTRNPM 191
            ||  ||..|.|.|:..|.|...:.|                 .||...||.:|.:|.|.|||...
Human   438 PGQFGRPVVVPHGKEKEAERRWKEG-----------------NFNVYLSDLIPVDRAIEDTRPAG 485

  Fly   192 CRTKKYREDLPETSVIITFHNEARSTLLRTIVSVLNRSPEHLIREIVLVDDYS--DHPEDGLE-- 252
            |..:....:||.||||:.|.:|..|||||::.||:||||.|||:||:||||:|  |:.:|.|:  
Human   486 CAEQLVHNNLPTTSVIMCFVDEVWSTLLRSVHSVINRSPPHLIKEILLVDDFSTKDYLKDNLDKY 550

  Fly   253 LAKIDKVRVIRNDKREGLVRSRVKGADAAVSSVLTFLDSHVECNEMWLEPLLERVREDPTRVVCP 317
            :::..|||::|..:|.||:|:|:.||..|...||||||||||||..|||||||||.....:|.||
Human   551 MSQFPKVRILRLKERHGLIRARLAGAQNATGDVLTFLDSHVECNVGWLEPLLERVYLSRKKVACP 615

  Fly   318 VIDVI--------SMDNFQYIGASADLRGGFDWNLIFKWEYLSPSERAMRHNDPTTAIRTPMIAG 374
            ||:||        ::||||        ||.|.|.:.|.|..:.|...|......|..||.|::||
Human   616 VIEVINDKDMSYMTVDNFQ--------RGIFVWPMNFGWRTIPPDVIAKNRIKETDTIRCPVMAG 672

  Fly   375 GLFVIDKAYFNKLGKYDMKMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKRHPYTFPGGS 439
            |||.|||:||.:||.||..:|||||||:|:||:||.|||.:||||||||||:||..:||:||...
Human   673 GLFSIDKSYFFELGTYDPGLDVWGGENMELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDR 737

  Fly   440 GNVFARNTRRAAEVWMDDYKQHYYNAVP--LAKNIPFGNIDDRLALKEKLHCKPFKWYLENVYPD 502
            .....||..|.||||:|:||:.:|....  :.:.:..||:..:..|::||.||.||||||||:||
Human   738 MKTVERNLVRVAEVWLDEYKELFYGHGDHLIDQGLDVGNLTQQRELRKKLKCKSFKWYLENVFPD 802

  Fly   503 LQAPDPQEVGQFRQDST-ECLDTMGHLIDGTVGIFPCHNTGGNQEWAFTKRGEIKHDDLCLTLVT 566
            |:||..:..|.....:. :|:.    :.:.||.:..|..:...|::.:|....||..:.|:..:.
Human   803 LRAPIVRASGVLINVALGKCIS----IENTTVILEDCDGSKELQQFNYTWLRLIKCGEWCIAPIP 863

  Fly   567 FARGSQVVLKACDD-SENQRWIMREGGL---------------------VRH--YKIN---VCLD 604
             .:|: |.|..||: ::..:|:.:...:                     |.|  ::.|   :||:
Human   864 -DKGA-VRLHPCDNRNKGLKWLHKSTSVFHPELLSNSACGSFPALLSLQVNHIVFENNQQLLCLE 926

  Fly   605 SRDQSQQGVSAQHCNSALGTQRWSFGKY 632
            . :.||:.:....|:.....|:|.|.||
Human   927 G-NFSQKILKVAACDPVKPYQKWKFEKY 953

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 129/243 (53%)
pp-GalNAc-T 205..500 CDD:133004 155/308 (50%)
Ricin_B_lectin 511..627 CDD:279046 25/143 (17%)
RICIN 513..629 CDD:238092 25/143 (17%)
GALNT5XP_016858726.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.