DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant2 and galnt15

DIOPT Version :9

Sequence 1:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster
Sequence 2:XP_002932836.2 Gene:galnt15 / 100489899 XenbaseID:XB-GENE-982198 Length:613 Species:Xenopus tropicalis


Alignment Length:466 Identity:172/466 - (36%)
Similarity:251/466 - (53%) Gaps:48/466 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 NRFNQEASDALPSNRDIPDTRNPMCRTKKYREDLPETSVIITFHNEARSTLLRTIVSVLNRSPEH 232
            |.|::|.|..:|.:|.|||.|:|.|..:.|.|.||..||||.||||..||||||:.|||:.||..
 Frog   135 NGFDEEVSKNIPLHRIIPDGRHPECLQQNYGEKLPIASVIICFHNEGWSTLLRTVHSVLDNSPRT 199

  Fly   233 LIREIVLVDDYS--DHPEDGLE--LAKIDKVRVIRNDKREGLVRSRVKGADAAVSSVLTFLDSHV 293
            .::||:||||.|  :|.:..|.  :::|..|::||::||.|::..|:.||..|...||.|:|||.
 Frog   200 FLKEIILVDDLSHQEHLKSALSEYISRIGGVKLIRSNKRLGVIGGRMLGAARATGEVLIFMDSHC 264

  Fly   294 ECNEMWLEPLLERVREDPTRVVCPVIDVISMDNFQYIGASADLRGGFDWNLIFKWEYLSPSERAM 358
            ||:..||||||.|:..:..|:|.||||.|....|:|..:|...:|.|||.|.|.|..|...|..:
 Frog   265 ECHPGWLEPLLSRIMHNRNRIVSPVIDFIDWKTFEYSHSSLLQQGVFDWKLDFHWVPLPEHEEKV 329

  Fly   359 RHNDPTTAIRTPMIAGGLFVIDKAYFNKLGKYDMKMDVWGGENLEISFRVWQCGGSLEIIPCSRV 423
            |.: |....|:|:|.|.:...|:.||..:|.:|..::.||.|..|:|.|||.||||:||:|||||
 Frog   330 RQS-PIIPFRSPVIPGYVLASDRHYFQNIGGFDTGINSWGVETTELSIRVWLCGGSVEIVPCSRV 393

  Fly   424 GHVFRKRHPYTFPGGSGNV-FARNTRRAAEVWMDDYKQHYYNAV--PLAKNIPFGNIDDRLALKE 485
            ||.::.   :|......|. ..|:..|.||:|||.||..:|..|  .|...|...:|::...|::
 Frog   394 GHAYQN---HTMHNSVQNEDVLRSKVRTAELWMDSYKAIFYRNVGNSLLNRIQESDINEHEQLRQ 455

  Fly   486 KLHCKPFKWYLENVYPDLQAPDPQEVGQFRQDSTECLDTMGHLIDGTVGIFPCH----------- 539
            :|.||.|:|:|.||||::..            ||..|::.|.|.:...|:...|           
 Frog   456 RLGCKRFQWFLANVYPEINM------------STSTLESSGQLFNAGFGLCMTHTFRERLFVTPV 508

  Fly   540 -----NTGGNQEWAFTKRGEIKHDD--LCLTLVTFARGSQVVLKACDDSE---NQRWIMREGGLV 594
                 :..|||.:.:....||:...  ||||:    |..|:..:.|..|:   ::.|...:.|.:
 Frog   509 KLSSCDENGNQVFEYNSVNEIRLTSVPLCLTV----RHEQISFENCTTSKPAASRLWHFGQAGSI 569

  Fly   595 RHYKINVCLDS 605
            .|.....|:::
 Frog   570 THIPTGKCIEA 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 107/235 (46%)
pp-GalNAc-T 205..500 CDD:133004 129/301 (43%)
Ricin_B_lectin 511..627 CDD:279046 24/116 (21%)
RICIN 513..629 CDD:238092 24/114 (21%)
galnt15XP_002932836.2 pp-GalNAc-T 172..470 CDD:133004 129/301 (43%)
Ricin_B_lectin 482..602 CDD:395527 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.