DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpa and AT4G08960

DIOPT Version :9

Sequence 1:NP_523466.2 Gene:Ptpa / 33555 FlyBaseID:FBgn0016698 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_567342.1 Gene:AT4G08960 / 826474 AraportID:AT4G08960 Length:392 Species:Arabidopsis thaliana


Alignment Length:308 Identity:114/308 - (37%)
Similarity:188/308 - (61%) Gaps:9/308 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AGKLPAIA---------KKVQNLGDMGVWQKSRAFHDLIGYINGTSSAIQGIKTTDEIFESEMLK 64
            |.::|.::         |::.:..|:..:.:|.:..:.:|::...|.:|:|.|.:|....|..:.
plant    84 AEQVPVVSPPYHFQSPVKRIHSPDDIRRFHESASCKNFLGFVVSLSESIRGFKISDPCHISPTVA 148

  Fly    65 KLLRLFDALEKLVEQNPPLEQPQRFGNKAYRDWAQAMRELLPELLEQLLPDDKKRYQVELGQYLT 129
            .::.:.:.|.:.:::.||.:|..|:||.::|.|.:.:||....|:.:.||::.|...:|:..|..
plant   149 AIVSILETLLQWIDEIPPAQQSARYGNVSFRSWHERLRERGESLILEFLPEEFKESVIEIVPYFF 213

  Fly   130 ESFGNATRIDYGTGHELSFLFFLCSLFKAEILQERDIVSAALRLFNRYLELARQLQRTYNMEPAG 194
            :||||::|||||||||.:|..:|..|.:..|::|.|..|...|:|.:||||.|:||..|.:||||
plant   214 DSFGNSSRIDYGTGHETNFAAWLYCLARMGIVKEEDYHSLVARVFVKYLELMRKLQMVYCLEPAG 278

  Fly   195 SQGVWSLDDFQFVPFIWGSAQLAVKSPFDPSKFVDEAIITEYKDHFMFISCIDYICKVKTGHFGE 259
            |.|||.|||:.|:|||:||:||.......|....::.|:..:...:|::|||.::.|||.|.|.|
plant   279 SHGVWGLDDYHFLPFIFGSSQLIDHKYMKPKSIHNDDILENFSSEYMYLSCIAFVKKVKKGLFAE 343

  Fly   260 HSNQLWSITDVPTWAKINAGLVKMYQKEILSKFPVIQHVYFGELMTFE 307
            ||..|..|:.||.|.|:|:||:|||:.|:|.|.|::||..||.|:.:|
plant   344 HSPLLDDISGVPNWKKVNSGLLKMYRVEVLEKVPIMQHFLFGWLIKWE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpaNP_523466.2 PTPA 17..308 CDD:281137 112/291 (38%)
AT4G08960NP_567342.1 PTPA 99..392 CDD:281137 112/293 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 233 1.000 Domainoid score I637
eggNOG 1 0.900 - - E1_COG5057
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6149
Inparanoid 1 1.050 235 1.000 Inparanoid score I1116
OMA 1 1.010 - - QHG54183
OrthoDB 1 1.010 - - D1165705at2759
OrthoFinder 1 1.000 - - FOG0002736
OrthoInspector 1 1.000 - - otm2771
orthoMCL 1 0.900 - - OOG6_101438
Panther 1 1.100 - - LDO PTHR10012
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.