DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpa and CG2104

DIOPT Version :9

Sequence 1:NP_523466.2 Gene:Ptpa / 33555 FlyBaseID:FBgn0016698 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001262299.1 Gene:CG2104 / 40702 FlyBaseID:FBgn0037365 Length:424 Species:Drosophila melanogaster


Alignment Length:370 Identity:150/370 - (40%)
Similarity:224/370 - (60%) Gaps:19/370 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KVQNLGDMGVWQKSRAFHDLIGYINGTSSAIQGIKTTDEIFESEMLKKLLRLFDALEKLVEQNPP 82
            :||:..||..|..|||:..||.|:|..|:.||||:.||....|:.:|:|..:|:.|:.::..|.|
  Fly    26 RVQSSSDMEAWLASRAYFTLITYLNDVSAEIQGIRNTDLFPISKNIKRLTTIFEQLDSMIVANSP 90

  Fly    83 LEQPQRFG------NKAYRDWAQAMRELLPELLEQLLPDDKKRYQVELGQYLTESFGNATRIDYG 141
              .|...|      .|:||.||..|...:.:::|:.:|..|.|:..|||.||:.|||::.:|:||
  Fly    91 --APLVLGANMDSRTKSYRRWAHGMLRDIYKIVEKAVPSSKCRHVNELGVYLSGSFGSSAKIEYG 153

  Fly   142 TGHELSFLFFLCSLFKAEIL-QERDIVSAALRLFNRYLELARQLQRTYNMEPAGSQGVWSLDDFQ 205
            ||||||||||:|:||||||| :|:|:.::||.||:|||...|:||.||::..:...|.:|||.||
  Fly   154 TGHELSFLFFVCALFKAEILDKEQDLAASALVLFDRYLHFVRRLQVTYSVNSSNWHGGYSLDKFQ 218

  Fly   206 FVPFIWGSAQLAVKSPFDPSKFVDEAIITEYKDHFMFISCIDYICKVKTGHFGEHSNQLWSITDV 270
            ||||:||.|||..::||.|.|.:||..|.:|:|.:|.|:|:.::.....|.|..||:||||:..:
  Fly   219 FVPFVWGFAQLCHEAPFSPKKMLDEDTIAKYRDAYMLINCVGHMATTNVGTFARHSSQLWSLAAL 283

  Fly   271 PTWAKINAGLVKMYQKEILSKFPVIQHVYFGELMTFEPVSSGTTLSNARLGHVAPPPSKRICIGT 335
            .:|.||:..|:.||.::||.....:..:.|||||:||...||..|.:||:| |..|..:::....
  Fly   284 SSWTKIHRSLMFMYMEDILMDIDNLNALRFGELMSFEEDKSGRHLGSARMG-VKSPLRRQMAEDP 347

  Fly   336 PNLVPPVPVATAPPPPAESLSIEQN--------VGDSSSESSDNS 372
            .:......:.:....|:.|.| |||        |.::||:...||
  Fly   348 DDQDQDQDLTSRSGTPSISRS-EQNDSARKKAKVEETSSDCMSNS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpaNP_523466.2 PTPA 17..308 CDD:281137 130/296 (44%)
CG2104NP_001262299.1 PTPA 44..314 CDD:239754 116/271 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468030
Domainoid 1 1.000 233 1.000 Domainoid score I637
eggNOG 1 0.900 - - E1_COG5057
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I1116
Isobase 1 0.950 - 0 Normalized mean entropy S1048
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1165705at2759
OrthoFinder 1 1.000 - - FOG0002736
OrthoInspector 1 1.000 - - otm46691
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2111
1110.850

Return to query results.
Submit another query.