DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpa and ptpa

DIOPT Version :9

Sequence 1:NP_523466.2 Gene:Ptpa / 33555 FlyBaseID:FBgn0016698 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_004916736.1 Gene:ptpa / 100125159 XenbaseID:XB-GENE-970102 Length:360 Species:Xenopus tropicalis


Alignment Length:331 Identity:144/331 - (43%)
Similarity:202/331 - (61%) Gaps:36/331 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KKVQNLGDMGVWQKSRAFHDLIGYINGTSSAIQGIKTTDEIFESE-------------------- 61
            |::..:.||..|::|:|:.|.:|::...:..::|.|.||:...||                    
 Frog    30 KEINMVPDMMKWKRSQAYTDYMGFVLALNEGVKGKKLTDDYKVSERLFQEGTGDRRAGAGNGFFC 94

  Fly    62 ----------------MLKKLLRLFDALEKLVEQNPPLEQPQRFGNKAYRDWAQAMRELLPELLE 110
                            ::.||:.|.|.|.:.:::.||::||.||||||:|.|...:.:....|:.
 Frog    95 GGSASSGEGQQIGWRVVIHKLMSLLDTLNRWIDEMPPVDQPSRFGNKAFRTWYAKLDKEAENLVS 159

  Fly   111 QLLPDDKKRYQVELGQYLTESFGNATRIDYGTGHELSFLFFLCSLFKAEILQERDIVSAALRLFN 175
            .::|........|:..||.||.||:||||||||||.:|..|||.|.|..||:..|.::...|:||
 Frog   160 TVIPVHLSAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGILKVDDQLAIVFRVFN 224

  Fly   176 RYLELARQLQRTYNMEPAGSQGVWSLDDFQFVPFIWGSAQLAVKSPFDPSKFVDEAIITEYKDHF 240
            ||||:.|:||:||.||||||||||.||||||:|||||||||...|..:|..||||.::.|:...:
 Frog   225 RYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSAQLIDHSILEPRHFVDEKVVNEHHKDY 289

  Fly   241 MFISCIDYICKVKTGHFGEHSNQLWSITDVPTWAKINAGLVKMYQKEILSKFPVIQHVYFGELMT 305
            ||:.||.:|.::|||.|.|||||||:|:.||.|:|:|.||::||:.|.|.|||||||..||.|:.
 Frog   290 MFLECILFITEMKTGPFAEHSNQLWNISAVPAWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLP 354

  Fly   306 FEPVSS 311
            .:||.|
 Frog   355 IQPVKS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpaNP_523466.2 PTPA 17..308 CDD:281137 141/326 (43%)
ptpaXP_004916736.1 PTPA 28..355 CDD:367331 141/324 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 285 1.000 Domainoid score I1593
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6149
Inparanoid 1 1.050 290 1.000 Inparanoid score I2741
OMA 1 1.010 - - QHG54183
OrthoDB 1 1.010 - - D1165705at2759
OrthoFinder 1 1.000 - - FOG0002736
OrthoInspector 1 1.000 - - oto103090
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.