DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9662 and AT4G29870

DIOPT Version :9

Sequence 1:NP_001259997.1 Gene:CG9662 / 33554 FlyBaseID:FBgn0031529 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_194716.1 Gene:AT4G29870 / 829109 AraportID:AT4G29870 Length:172 Species:Arabidopsis thaliana


Alignment Length:142 Identity:64/142 - (45%)
Similarity:93/142 - (65%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LPFHILVPPNIKVRRFSIPMPSPMAVFSVILFSYFLVTGGIIYDVIVEPPSLGATVDE-HGHSRP 71
            :||..|.||.::::..|..:||||.|||:||.:||||..|.:||||||||.:|:|.|. .|..||
plant    31 IPFSFLRPPRLRLKLPSFTLPSPMTVFSLILLTYFLVVSGFVYDVIVEPPGIGSTQDPITGSVRP 95

  Fly    72 VAFMPYRVNGQYIMEGLASSFLFTVGGLGFIIMDQTHTPGKTNLNRLLLTAMGFIFILVSFFTTW 136
            |.||..|||||||:|||:|.|:|.:||:|.|::|......:....:......|...|::::..:.
plant    96 VVFMSGRVNGQYIIEGLSSGFMFVLGGIGIIMLDLALDKNRAKSVKASYATAGVSSIVIAYVMSM 160

  Fly   137 LFMRMKLPSYLQ 148
            ||:|:|:|.||:
plant   161 LFIRIKIPGYLR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9662NP_001259997.1 OST3_OST6 <38..146 CDD:398430 48/108 (44%)
AT4G29870NP_194716.1 OST3_OST6 30..156 CDD:282594 57/124 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 117 1.000 Domainoid score I1955
eggNOG 1 0.900 - - E1_KOG3356
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10933
Inparanoid 1 1.050 133 1.000 Inparanoid score I1855
OMA 1 1.010 - - QHG59793
OrthoDB 1 1.010 - - D1575260at2759
OrthoFinder 1 1.000 - - FOG0005803
OrthoInspector 1 1.000 - - otm2429
orthoMCL 1 0.900 - - OOG6_105838
Panther 1 1.100 - - LDO PTHR13160
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4193
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.