DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9662 and AT2G19340

DIOPT Version :9

Sequence 1:NP_001259997.1 Gene:CG9662 / 33554 FlyBaseID:FBgn0031529 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_849986.1 Gene:AT2G19340 / 816451 AraportID:AT2G19340 Length:200 Species:Arabidopsis thaliana


Alignment Length:137 Identity:58/137 - (42%)
Similarity:84/137 - (61%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LPFHILVPPNIKVRRFSIPMPSPMAVFSVILFSYFLVTGGIIYDVIVEPPSLGATVD-EHGHSRP 71
            :||..|.||.::::..|..:||||.|:::||.:||||..|.:||||||||.:|:|.| ..|..||
plant    32 VPFSFLRPPRLRLKIPSFTLPSPMTVYALILLTYFLVVSGFVYDVIVEPPGIGSTQDPTTGTIRP 96

  Fly    72 VAFMPYRVNGQYIMEGLASSFLFTVGGLGFIIMDQTHTPGKTNLNRLLLTAMGFIFILVSFF--- 133
            |.||..|||||||:|||:|.|:|.:||:|.:::|......|....:......|...|::::.   
plant    97 VVFMSGRVNGQYIIEGLSSGFMFVLGGIGIVMLDLALDKNKAKSVKASYAVAGVSSIVIAYVMSS 161

  Fly   134 ----TTW 136
                |||
plant   162 WRKETTW 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9662NP_001259997.1 OST3_OST6 <38..146 CDD:398430 46/107 (43%)
AT2G19340NP_849986.1 OST3_OST6 <53..157 CDD:282594 48/103 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 117 1.000 Domainoid score I1955
eggNOG 1 0.900 - - E1_KOG3356
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10933
Inparanoid 1 1.050 133 1.000 Inparanoid score I1855
OMA 1 1.010 - - QHG59793
OrthoDB 1 1.010 - - D1575260at2759
OrthoFinder 1 1.000 - - FOG0005803
OrthoInspector 1 1.000 - - otm2429
orthoMCL 1 0.900 - - OOG6_105838
Panther 1 1.100 - - O PTHR13160
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4193
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.